GPRC5B Antibody - BSA Free

Immunohistochemistry-Paraffin: GPRC5B Antibody [NBP1-87160] - Analysis in human cerebral cortex and liver tissues. Corresponding GPRC5B RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: GPRC5B Antibody [NBP1-87160] - Staining of human cell line U-251 MG shows localization to nucleus and vesicles.

Immunohistochemistry-Paraffin: GPRC5B Antibody [NBP1-87160] - Staining of human caudate putamen shows strong membranous positivity in glial cells.

Immunohistochemistry-Paraffin: GPRC5B Antibody [NBP1-87160] - Staining of human cerebral cortex shows strong membranous positivity in neuropil.

Immunohistochemistry-Paraffin: GPRC5B Antibody [NBP1-87160] - Staining of human kidney shows strong membranous positivity in cells in glomeruli and distal tubules.

Immunohistochemistry-Paraffin: GPRC5B Antibody [NBP1-87160] - Staining of human liver shows weak positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: GPRC5B Antibody [NBP1-87160] - Staining of human testis shows strong membranous and cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPRC5B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPRC5B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GPRC5B Protein (NBP1-87160PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPRC5B Antibody - BSA Free

• G protein-coupled receptor, family C, group 1, member B
• G protein-coupled receptor, family C, group 5, member B
• GPRC5B
• RAIG2
• RAIG-2A-69G12.1
• RAIG2G-protein coupled receptor family C group 5 member B
• retinoic acid responsive gene protein
• Retinoic acid-induced gene 2 protein

Background

GPRC5B is an Orphan-C GPCR induced by retinoids. GPRC5B shows some homologies to the metabotropic glutamate receptor-like family of GPCRs; however, the GPRC5B protein has a short N-terminal domain compared to other family C members. GPRC5B expression is reported to be widespread with highest levels observed in brain, kidney, pancreas and testis. ESTs have been isolated from a wide variety of human tissue libraries, including normal adrenal, brain, heart/melanocyte/uterus and pineal, and cancerous germ cell, nerve, ovary and parathyroid.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPRC5B