GPR8 Antibody - BSA Free Summary
Description |
Novus Biologicals Rabbit GPR8 Antibody - BSA Free (NBP2-86660) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human GPR8. Peptide sequence: SQDNGTGHNATFSEPLPFLYVLLPAVYSGICAVGLTGNTAVILVILRAPK The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
NPBWR2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for GPR8 Antibody - BSA Free
Background
GPR8 is a Neuropeptide Receptor GPCR. GPR8 is implicated in the regulation of feeding and prolactin release by binding to NPW. GPR8 has been reported in the brain.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Dr, Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Bv, Hu, Mu
Applications: ICC, IHC
Publications for GPR8 Antibody (NBP2-86660) (0)
There are no publications for GPR8 Antibody (NBP2-86660).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPR8 Antibody (NBP2-86660) (0)
There are no reviews for GPR8 Antibody (NBP2-86660).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GPR8 Antibody (NBP2-86660) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GPR8 Products
Research Areas for GPR8 Antibody (NBP2-86660)
Find related products by research area.
|
Blogs on GPR8