GPR37 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit GPR37 Antibody - BSA Free (NBP2-49540) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: RAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GPR37 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GPR37 Antibody - BSA Free
Background
GPR37 is an Orphan-A GPCR with an unknown ligand. GPR37 was recently identified as the PAEL receptor, a Parkin substrate involved in autosomal recessive juvenile Parkinson's (PDJ) disease. The PAEL receptor becomes unfolded, insoluble, and ubiquitinated when overexpressed, leading to unfolded protein-induced cell death. When the PAEL receptor is ubiquitinated by Parkin, it gets degraded, resulting in the suppression of cell death. The insoluble form of the PAEL receptor accumulates in the brains of PDJ patients and may cause selective neuronal death. GPR37 expression has been reported in brain, liver, and placenta. ESTs have been isolated from brain, embryo, eye, fetal lung/testis/Bcell, gallbladder, heart, liver, liver/spleen, melanocyte/uterus/fetal heart, nerve, placenta, testis, tonsil, and vessel libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IP, WB
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Publications for GPR37 Antibody (NBP2-49540) (0)
There are no publications for GPR37 Antibody (NBP2-49540).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPR37 Antibody (NBP2-49540) (0)
There are no reviews for GPR37 Antibody (NBP2-49540).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for GPR37 Antibody (NBP2-49540) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GPR37 Products
Research Areas for GPR37 Antibody (NBP2-49540)
Find related products by research area.
|
Blogs on GPR37