GPR37 Antibody - BSA Free

Immunohistochemistry: GPR37 Antibody [NBP2-49540] - Staining of human cerebral cortex shows moderate positivity in neuropil.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPR37 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPR37 Antibody - BSA Free (NBP2-49540) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR37
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GPR37 Recombinant Protein Antigen (NBP2-49540PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPR37 Antibody - BSA Free

• EDNRBL
• Endothelin B receptor-like protein 1
• ETBR-LP-1
• G protein-coupled receptor 37 (endothelin receptor type B-like)
• GPR37
• hET(B)R-LP
• PAELR
• PAELRETBR-LP-1
• Parkin-associated endothelin receptor-like receptor
• probable G-protein coupled receptor 37

Background

GPR37 is an Orphan-A GPCR with an unknown ligand. GPR37 was recently identified as the PAEL receptor, a Parkin substrate involved in autosomal recessive juvenile Parkinson's (PDJ) disease. The PAEL receptor becomes unfolded, insoluble, and ubiquitinated when overexpressed, leading to unfolded protein-induced cell death. When the PAEL receptor is ubiquitinated by Parkin, it gets degraded, resulting in the suppression of cell death. The insoluble form of the PAEL receptor accumulates in the brains of PDJ patients and may cause selective neuronal death. GPR37 expression has been reported in brain, liver, and placenta. ESTs have been isolated from brain, embryo, eye, fetal lung/testis/Bcell, gallbladder, heart, liver, liver/spleen, melanocyte/uterus/fetal heart, nerve, placenta, testis, tonsil, and vessel libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR37