GPR37 Antibody

Images

 
Immunohistochemistry: GPR37 Antibody [NBP2-49540] - Staining of human cerebral cortex shows moderate positivity in neuropil.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR37 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYG
Specificity
Specificity of human GPR37 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR37
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPR37 Recombinant Protein Antigen (NBP2-49540PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR37 Antibody

  • EDNRBL
  • Endothelin B receptor-like protein 1
  • ETBR-LP-1
  • G protein-coupled receptor 37 (endothelin receptor type B-like)
  • GPR37
  • hET(B)R-LP
  • PAELR
  • PAELRETBR-LP-1
  • Parkin-associated endothelin receptor-like receptor
  • probable G-protein coupled receptor 37

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29838
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NB100-2526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KO
NLS418
Species: Hu
Applications: IHC-P
NLS2756
Species: Hu, Mk
Applications: IHC-P, ICC
NLS442
Species: Hu
Applications: IHC-P
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-02393
Species: Hu
Applications: IHC, IHC-P
MAB5579
Species: Hu
Applications: ICC
NLS54
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC-P, ICC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49540
Species: Hu
Applications: IHC, IHC-P

Publications for GPR37 Antibody (NBP2-49540) (0)

There are no publications for GPR37 Antibody (NBP2-49540).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR37 Antibody (NBP2-49540) (0)

There are no reviews for GPR37 Antibody (NBP2-49540). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPR37 Antibody (NBP2-49540) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GPR37 Antibody (NBP2-49540)

Discover related pathways, diseases and genes to GPR37 Antibody (NBP2-49540). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR37 Antibody (NBP2-49540)

Discover more about diseases related to GPR37 Antibody (NBP2-49540).
 

Pathways for GPR37 Antibody (NBP2-49540)

View related products by pathway.

PTMs for GPR37 Antibody (NBP2-49540)

Learn more about PTMs related to GPR37 Antibody (NBP2-49540).
 

Research Areas for GPR37 Antibody (NBP2-49540)

Find related products by research area.

Blogs on GPR37

There are no specific blogs for GPR37, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR37 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR37
Entrez