GPR19 Antibody

Images

 
Immunohistochemistry-Paraffin: GPR19 Antibody [NBP1-87572] Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RMDNSKPHLIIPTLLVPLQNRSCTETATPLPSQYLMELSEEHSWMSNQTD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPR19 Protein (NBP1-87572PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR19 Antibody

  • G protein-coupled receptor 19
  • GPR19
  • GPR-NGA
  • probable G-protein coupled receptor 19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS418
Species: Hu
Applications: IHC-P
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-56768
Species: Hu
Applications: ICC/IF
MAB5248
Species: Hu
Applications: IHC
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GPR19 Antibody (NBP1-87572) (0)

There are no publications for GPR19 Antibody (NBP1-87572).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR19 Antibody (NBP1-87572) (0)

There are no reviews for GPR19 Antibody (NBP1-87572). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPR19 Antibody (NBP1-87572) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR19 Products

Bioinformatics Tool for GPR19 Antibody (NBP1-87572)

Discover related pathways, diseases and genes to GPR19 Antibody (NBP1-87572). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR19 Antibody (NBP1-87572)

Discover more about diseases related to GPR19 Antibody (NBP1-87572).
 

Pathways for GPR19 Antibody (NBP1-87572)

View related products by pathway.

PTMs for GPR19 Antibody (NBP1-87572)

Learn more about PTMs related to GPR19 Antibody (NBP1-87572).
 

Research Areas for GPR19 Antibody (NBP1-87572)

Find related products by research area.

Blogs on GPR19

There are no specific blogs for GPR19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR19
Entrez