GPR171 Antibody

Images

 
Western Blot: GPR171 Antibody [NBP2-32359] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: GPR171 Antibody [NBP2-32359] - Staining of human esophagus shows cytoplasmic and nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR171 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LSKAFRSKVTETFASPKETKAQKEKLRCENNA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR171
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPR171 Protein (NBP2-32359PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR171 Antibody

  • F730001G15Rik
  • G protein-coupled receptor 171
  • GPR171
  • G-protein coupled receptor H963
  • H963
  • H963platelet activating receptor homolog
  • probable G-protein coupled receptor 171

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4617
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-81760
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-00861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1584
Species: Hu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NBP2-24672
Species: Hu
Applications: WB
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-19819
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00011266-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
MAB6549
Species: Hu
Applications: WB
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-77033
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-56456
Species: Hu
Applications: ICC/IF, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-83345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32359
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GPR171 Antibody (NBP2-32359) (0)

There are no publications for GPR171 Antibody (NBP2-32359).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR171 Antibody (NBP2-32359) (0)

There are no reviews for GPR171 Antibody (NBP2-32359). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR171 Antibody (NBP2-32359) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR171 Products

Bioinformatics Tool for GPR171 Antibody (NBP2-32359)

Discover related pathways, diseases and genes to GPR171 Antibody (NBP2-32359). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR171 Antibody (NBP2-32359)

Discover more about diseases related to GPR171 Antibody (NBP2-32359).

Research Areas for GPR171 Antibody (NBP2-32359)

Find related products by research area.

Blogs on GPR171

There are no specific blogs for GPR171, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR171 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR171
Entrez