GPR162 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

GPR162 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR162.
  
  

  Source: E. coli

  Amino Acid Sequence: KLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GPR162
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33740.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

  For further blocking peptide related information and a protocol, click here.

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GPR162 Recombinant Protein Antigen

• A-2
• FLJ78837
• G protein-coupled receptor 162
• Gene-rich cluster gene A protein
• GPR162
• GRCA
• GRCAgene rich cluster, A
• probable G-protein coupled receptor 162

Background

GPR162, also known as Probable G-protein coupled receptor 162, has a 588 amino acid long isoform that is 64 kDa and a short 304 amino acid isoform that is 33 kDa, located in the cell membrane, mainly expressed in the brain; acts as an orphan receptor. This protein is being studied for its involvement in St. Louis encephalitis, amyotrophic lateral sclerosis, lymphoma, asphyxia neonatorum, dental caries, spotted fever, typhus, lyme disease, toxic shock syndrome, cystic fibrosis, purpura, pancreatic cancer, and pancreatitis. It has been inferred that GPR162 protein is involved in G-protein coupled receptor signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR162