GPR1 Antibody

Images

 
Western Blot: GPR1 Antibody [H00002825-B01P] - Analysis of GPR1 expression in transfected 293T cell line by GPR1 polyclonal antibody. Lane 1: GPR1 transfected lysate(41.40 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GPR1 Antibody Summary

Immunogen
GPR1 (NP_005270.2, 1 a.a. - 355 a.a.) full-length human protein. MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ
Specificity
Reacts with G protein-coupled receptor 1.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GPR1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GPR1 Antibody

  • G protein-coupled receptor 1
  • GPR1
  • probable G-protein coupled receptor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-11228
Species: Hu
NLS1194
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB699
Species: Hu
Applications: Flow, CyTOF-reported
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NLS145
Species: Hu, Ca, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB3654
Species: Hu
Applications: Flow, CyTOF-ready

Publications for GPR1 Antibody (H00002825-B01P) (0)

There are no publications for GPR1 Antibody (H00002825-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR1 Antibody (H00002825-B01P) (0)

There are no reviews for GPR1 Antibody (H00002825-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR1 Antibody (H00002825-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR1 Products

Bioinformatics Tool for GPR1 Antibody (H00002825-B01P)

Discover related pathways, diseases and genes to GPR1 Antibody (H00002825-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR1 Antibody (H00002825-B01P)

Discover more about diseases related to GPR1 Antibody (H00002825-B01P).
 

Pathways for GPR1 Antibody (H00002825-B01P)

View related products by pathway.

PTMs for GPR1 Antibody (H00002825-B01P)

Learn more about PTMs related to GPR1 Antibody (H00002825-B01P).
 

Research Areas for GPR1 Antibody (H00002825-B01P)

Find related products by research area.

Blogs on GPR1

There are no specific blogs for GPR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR1
Entrez
Uniprot