GPM6B Antibody

Western Blot: GPM6B Antibody [NBP2-82914] - Host: Rabbit. Target Name: GPM6B. Sample Type: COLO205 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Discontinued

GPM6B Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPM6B. Peptide sequence: SGVALFCGCGHVALAGTVAILEQHFSTNASDHALLSEVIQLMQYVIYGIA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPM6B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPM6B Antibody

• glycoprotein M6B
• M6b
• M6Bneuronal membrane glycoprotein M6-b
• MGC17150
• MGC54284
• protolipid M6B

Background

The GPM6B gene encodes a membrane glycoprotein that belongs to the proteolipid protein family. Proteolipid protein familymembers are expressed in most brain regions and are thought to be involved in cellular housekeeping functions, such asmembrane trafficking

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPM6B