GOSR1 Recombinant Protein Antigen

Images

 
There are currently no images for GOSR1 Protein (NBP1-83351PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GOSR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GOSR1.

Source: E. coli

Amino Acid Sequence: TGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMGSVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLANRFPAVNSLIQRINLRKR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GOSR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83351.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GOSR1 Recombinant Protein Antigen

  • golgi integral membrane protein 2
  • golgi SNAP receptor complex member 1,28 kDa cis-Golgi SNARE p28
  • Golgi SNARE 28 kDa
  • GOLIM2
  • GOS28cis-golgi SNARE
  • GOS-28GOS28/P28
  • GOSR1
  • GS28
  • GS2828 kDa Golgi SNARE protein
  • p28

Background

In eukaryotic cells, the Golgi apparatus receives newly synthesized proteins from the endoplasmic reticulum (ER) and delivers them after covalent modification to their destination in the cell. Although little is known about membrane-tubule-mediated transport, the molecular mechanism for vesicle-mediated transport is quite well understood, occurring through docking of SNAREs on the vesicle with those on the target membrane. (1). Transport of proteins along the exocytotic pathway is primarily achieved by vesicular intermediates. Two proteins, Golgi SNAREs of 27 kDa, GS27, and of 28 kDa, GS28 are important trafficking membrane proteins between the endoplasmic reticulum and the Golgi and between Golgi subcompartments (2). In vitro, GOS-28, A Golgi SNARE of 28 kD, is efficiently packaged into Golgi-derived vesicles, which are most likely COPI coated. Antibodies directed against GOS-28 block its ability to bind alpha-SNAP, partially inhibit transport from the cis to the medial cisternae, and do not inhibit budding of COP-coated vesicles, but do accumulate docked uncoated vesicles (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB2274
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
NBP1-87430
Species: Hu
Applications: IHC,  IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00010263-B01P
Species: Hu, Mu, Rt
Applications: WB
2526-IL
Species: Hu
Applications: BA
NBP1-86784
Species: Hu
Applications: IHC,  IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
1290-IL
Species: Hu
Applications: BA
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP2-27362
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, TCS, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-83351PEP
Species: Hu
Applications: AC

Publications for GOSR1 Protein (NBP1-83351PEP) (0)

There are no publications for GOSR1 Protein (NBP1-83351PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GOSR1 Protein (NBP1-83351PEP) (0)

There are no reviews for GOSR1 Protein (NBP1-83351PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GOSR1 Protein (NBP1-83351PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GOSR1 Products

Research Areas for GOSR1 Protein (NBP1-83351PEP)

Find related products by research area.

Blogs on GOSR1

There are no specific blogs for GOSR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GOSR1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GOSR1