GNPDA1 Recombinant Protein Antigen

Images

 
There are currently no images for GNPDA1 Recombinant Protein Antigen (NBP2-33474PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GNPDA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GNPDA2.

Source: E. coli

Amino Acid Sequence: LSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDAT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GNPDA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33474.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GNPDA1 Recombinant Protein Antigen

  • EC 3.5.99.6
  • GlcN6P deaminase 1
  • glucosamine-6-phosphate deaminase 1KIAA0060HLNGNPIGNPDA
  • glucosamine-6-phosphate isomerase 1
  • glucosamine-6-phosphate isomerase
  • GNP1
  • GNPDA 1
  • GPI
  • oscillin

Background

GNPDA1, also known as Glucosamine-6-phosphate isomerase 1, is a 289 amino acid that is 33 kDa, with homohexamer subunit structure and cytoplasm location; is an allosteric enzyme that catalyzes the reversible conversion of D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium; and appears to trigger calcium oscillations in mammalian eggs which operate as the basic trigger for egg activation and early development of the embryo. Disease research is currently being studied with relation to GNPDA1 and lipoid nephrosis, hepatocellular carcinoma, and acute interstitial pneumonia. The protein has been linked to the amino sugar and nucleotide sugar metabolism and metabolic pathways where it interacts with MCC, EWSR1, ILF2, AMDHD2, and GP1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2009
Species: Hu
Applications: ICC, IHC
NB500-330
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP
NB100-56605
Species: Av, Bv, Sh
Applications: WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-13760
Species: Hu
Applications: IHC, IHC-P
NBP1-84796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF5128
Species: Hu, Mu, Rt
Applications: WB
AF4466
Species: Hu, Mu
Applications: WB
NBP1-33050
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52533
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-88262
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-92873
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
DUP00
Species: Hu
Applications: ELISA

Publications for GNPDA1 Recombinant Protein Antigen (NBP2-33474PEP) (0)

There are no publications for GNPDA1 Recombinant Protein Antigen (NBP2-33474PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNPDA1 Recombinant Protein Antigen (NBP2-33474PEP) (0)

There are no reviews for GNPDA1 Recombinant Protein Antigen (NBP2-33474PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GNPDA1 Recombinant Protein Antigen (NBP2-33474PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GNPDA1 Products

Research Areas for GNPDA1 Recombinant Protein Antigen (NBP2-33474PEP)

Find related products by research area.

Blogs on GNPDA1

There are no specific blogs for GNPDA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GNPDA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GNPDA1