GNG5 Antibody (3B8) - Azide and BSA Free

Sandwich ELISA: GNG5 Antibody (3B8) [H00002787-M04] - Detection limit for recombinant GST tagged GNG5 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3B8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GNG5 Antibody (3B8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GNG5 (AAH03563, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL
• Specificity: Reacts with guanine nucleotide binding protein (G protein), gamma 5.
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GNG5
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GNG5 Antibody (3B8) - Azide and BSA Free

• FLJ92393
• GNGT5
• guanine nucleotide binding protein (G protein), gamma 5
• guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5

Background

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in varioustransmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement ofGDP by GTP, and for G protein-effector interaction

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNG5
• Entrez:
  • 2787(Human)
• Uniprot:
  • AAH03563(Human)