GNB1L Recombinant Protein Antigen

Product Discontinued

GNB1L Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GNB1L.
  
  

  Source: E. coli

  Amino Acid Sequence: VDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GNB1L
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81787.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GNB1L Recombinant Protein Antigen

• DGCRK3
• G-protein beta subunit-like protein
• guanine nucleotide binding protein (G protein), beta polypeptide 1-like
• guanine nucleotide binding protein beta-subunit-like polypeptide
• guanine nucleotide-binding protein subunit beta-like protein 1
• GY2WD40 repeat-containing protein deleted in VCFS
• KIAA1645
• WD repeat-containing protein 14
• WDR14G protein subunit beta-like protein 1
• WDVCF

Background

The GNB1L gene codes a guanine nucleotide-binding protein subunit beta-like protein 1 that is a member of the WD repeat protein family. Isoform 1 is 327 amino acids long with a mass of around 35 kDA while isoform 2 exists at 212 amino acids long and nearly 23 kDA. Members of the WD repeat protein family are known for their involvement in many cellular responses such as: cycle progression, signal transduction, apoptosis, and gene regulation. The GNB1L gene can be found on chromosome 22q11, and if deleted, will cause DiGeorge syndrome. The GNB1L gene has been researched regarding its role in schizophrenia, spinal cord disease, carcinoma, cat eye syndrome, hypopharynx cancer, and visceral leishmaniasis. GNB1L gene interacts with genes KLHL12 and UBC in pathways such as the beta-agonist/beta blocker.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GNB1L