GNA14 Antibody


Western Blot: GNA14 Antibody [NBP1-98546] - Antibody Dilution: 1.0ug/ml Sample Tissue: Human brain.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

GNA14 Antibody Summary

The immunogen for this antibody is GNA14 - N-terminal region. Peptide sequence QLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GNA14 Antibody

  • G alpha-14
  • G-protein subunit alpha-14
  • guanine nucleotide binding protein (G protein), alpha 14
  • guanine nucleotide-binding protein 14
  • guanine nucleotide-binding protein subunit alpha-14


This gene encodes a member of the guanine nucleotide-binding, or G protein family. G proteins are heterotrimers consisting of alpha, beta and gamma subunits. The encoded protein is a member of the alpha family of G proteins, more specifically the alpha q subfamily of G proteins. The encoded protein may play a role in pertussis-toxin resistant activation of phospholipase C-beta and its downstream effectors.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IP, ICC, ICFlow, KO
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
Species: Hu, Po, Bv, Ca, Eq
Applications: IHC-P
Species: Hu
Applications: WB

Publications for GNA14 Antibody (NBP1-98546) (0)

There are no publications for GNA14 Antibody (NBP1-98546).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNA14 Antibody (NBP1-98546) (0)

There are no reviews for GNA14 Antibody (NBP1-98546). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNA14 Antibody (NBP1-98546) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for GNA14 Antibody (NBP1-98546)

Discover related pathways, diseases and genes to GNA14 Antibody (NBP1-98546). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNA14 Antibody (NBP1-98546)

Discover more about diseases related to GNA14 Antibody (NBP1-98546).

Pathways for GNA14 Antibody (NBP1-98546)

View related products by pathway.

PTMs for GNA14 Antibody (NBP1-98546)

Learn more about PTMs related to GNA14 Antibody (NBP1-98546).

Research Areas for GNA14 Antibody (NBP1-98546)

Find related products by research area.

Blogs on GNA14

There are no specific blogs for GNA14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GNA14 Antibody and receive a gift card or discount.


Gene Symbol GNA14