GNA14 Antibody

Images

 
Western Blot: GNA14 Antibody [NBP1-98546] - Antibody Dilution: 1.0ug/ml Sample Tissue: Human brain.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GNA14 Antibody Summary

Immunogen
The immunogen for this antibody is GNA14 - N-terminal region. Peptide sequence QLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNA14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GNA14 Antibody

  • G alpha-14
  • G-protein subunit alpha-14
  • guanine nucleotide binding protein (G protein), alpha 14
  • guanine nucleotide-binding protein 14
  • guanine nucleotide-binding protein subunit alpha-14

Background

This gene encodes a member of the guanine nucleotide-binding, or G protein family. G proteins are heterotrimers consisting of alpha, beta and gamma subunits. The encoded protein is a member of the alpha family of G proteins, more specifically the alpha q subfamily of G proteins. The encoded protein may play a role in pertussis-toxin resistant activation of phospholipase C-beta and its downstream effectors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-85641
Species: Hu
Applications: IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB300-157
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-62667
Species: Hu
Applications: IHC, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP2-37582
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-48700
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP2-20571
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98546
Species: Hu
Applications: WB

Publications for GNA14 Antibody (NBP1-98546) (0)

There are no publications for GNA14 Antibody (NBP1-98546).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNA14 Antibody (NBP1-98546) (0)

There are no reviews for GNA14 Antibody (NBP1-98546). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNA14 Antibody (NBP1-98546) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GNA14 Products

Bioinformatics Tool for GNA14 Antibody (NBP1-98546)

Discover related pathways, diseases and genes to GNA14 Antibody (NBP1-98546). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNA14 Antibody (NBP1-98546)

Discover more about diseases related to GNA14 Antibody (NBP1-98546).
 

Pathways for GNA14 Antibody (NBP1-98546)

View related products by pathway.

PTMs for GNA14 Antibody (NBP1-98546)

Learn more about PTMs related to GNA14 Antibody (NBP1-98546).
 

Research Areas for GNA14 Antibody (NBP1-98546)

Find related products by research area.

Blogs on GNA14

There are no specific blogs for GNA14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GNA14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNA14
Uniprot