GMPR1 Recombinant Protein Antigen

Images

 
There are currently no images for GMPR1 Protein (NBP1-87459PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GMPR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GMPR.

Source: E.coli

Amino Acid Sequence: DTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYS

Protein/Peptide Type
Recombinant Protein Antigen
Gene
GMPR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87459.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GMPR1 Recombinant Protein Antigen

  • EC 1.7.1.7
  • GMPR1GMP reductase 1
  • guanine monophosphate reductase
  • Guanosine 5'-monophosphate oxidoreductase 1
  • Guanosine monophosphate reductase 1
  • guanosine monophosphate reductase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86183
Species: Hu
Applications: WB, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
MAB7020
Species: Hu
Applications: WB, IHC
H00005555-P01
Species: Hu
NBP1-54903
Species: Hu
Applications: WB
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86177
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32631
Species: Hu
Applications: IHC, IHC-P
NBP1-87459PEP
Species: Hu
Applications: AC

Publications for GMPR1 Protein (NBP1-87459PEP) (0)

There are no publications for GMPR1 Protein (NBP1-87459PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GMPR1 Protein (NBP1-87459PEP) (0)

There are no reviews for GMPR1 Protein (NBP1-87459PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for GMPR1 Protein (NBP1-87459PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GMPR1 Products

Bioinformatics Tool for GMPR1 Protein (NBP1-87459PEP)

Discover related pathways, diseases and genes to GMPR1 Protein (NBP1-87459PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GMPR1 Protein (NBP1-87459PEP)

Discover more about diseases related to GMPR1 Protein (NBP1-87459PEP).

Blogs on GMPR1

There are no specific blogs for GMPR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GMPR1 Antibody
NBP1-87459
GMPR1 Antibody
NBP1-87459

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GMPR1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GMPR