GML Antibody (1E7.)

Images

 
There are currently no images for GML Antibody (H00002765-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E7.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GML Antibody (1E7.) Summary

Immunogen
GML (NP_002057, 48 a.a. - 158 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CPYHIRRCMTISIRINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLERDMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GML
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GML Antibody (1E7.)

  • glycosylphosphatidylinositol anchored molecule like protein
  • glycosyl-phosphatidylinositol-anchored molecule-like protein
  • Glycosylphosphatidylinositol-anchored molecule-like protein
  • LY6DLGPI anchored molecule like protein

Background

Glycosyl-phosphatidylinositol-anchored molecule-like protein (GML) may play a role in the apoptotic pathway or cell-cycle regulation induced by p53 after DNA damage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-86665
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-52926
Species: Hu
Applications: WB
NBP2-31881
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2009
Species: Hu
Applications: WB, IHC
NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
H00030813-R02
Species: Hu
H00004061-D01P
Species: Hu
Applications: WB
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-89755
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00002765-M02
Species: Hu
Applications: WB, ELISA

Publications for GML Antibody (H00002765-M02) (0)

There are no publications for GML Antibody (H00002765-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GML Antibody (H00002765-M02) (0)

There are no reviews for GML Antibody (H00002765-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GML Antibody (H00002765-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GML Products

Bioinformatics Tool for GML Antibody (H00002765-M02)

Discover related pathways, diseases and genes to GML Antibody (H00002765-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GML Antibody (H00002765-M02)

Discover more about diseases related to GML Antibody (H00002765-M02).
 

Pathways for GML Antibody (H00002765-M02)

View related products by pathway.

PTMs for GML Antibody (H00002765-M02)

Learn more about PTMs related to GML Antibody (H00002765-M02).
 

Research Areas for GML Antibody (H00002765-M02)

Find related products by research area.

Blogs on GML

There are no specific blogs for GML, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GML Antibody (1E7.) and receive a gift card or discount.

Bioinformatics

Gene Symbol GML
Uniprot