Glycogen synthase 2 Antibody (8H3)

Images

 
Western Blot: Glycogen synthase 2 Antibody (8H3) [H00002998-M06] - Detection against Immunogen (36.74 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
8H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Glycogen synthase 2 Antibody (8H3) Summary

Immunogen
GYS2 (NP_068776.1, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLRGRSLSVTSLGGLPQWEVEELPVEELLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWGENYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGC
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GYS2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glycogen synthase 2 Antibody (8H3)

  • EC 2.4.1.11
  • glycogen [starch] synthase, liver
  • glycogen synthase 2 (liver)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP2-41193
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
H00005071-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-60930
Species: Hu, Mu
Applications: WB
NBP1-91191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-53421
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94015
Species: Hu
Applications: IHC, IHC-P
NBP1-31365
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Glycogen synthase 2 Antibody (H00002998-M06) (0)

There are no publications for Glycogen synthase 2 Antibody (H00002998-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glycogen synthase 2 Antibody (H00002998-M06) (0)

There are no reviews for Glycogen synthase 2 Antibody (H00002998-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glycogen synthase 2 Antibody (H00002998-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glycogen synthase 2 Products

Bioinformatics Tool for Glycogen synthase 2 Antibody (H00002998-M06)

Discover related pathways, diseases and genes to Glycogen synthase 2 Antibody (H00002998-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycogen synthase 2 Antibody (H00002998-M06)

Discover more about diseases related to Glycogen synthase 2 Antibody (H00002998-M06).
 

Pathways for Glycogen synthase 2 Antibody (H00002998-M06)

View related products by pathway.

PTMs for Glycogen synthase 2 Antibody (H00002998-M06)

Learn more about PTMs related to Glycogen synthase 2 Antibody (H00002998-M06).

Blogs on Glycogen synthase 2

There are no specific blogs for Glycogen synthase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glycogen synthase 2 Antibody (8H3) and receive a gift card or discount.

Bioinformatics

Gene Symbol GYS2
Uniprot