Glycogen phosphorylase, muscle form Antibody (3D8)

Images

 
Sandwich ELISA: Glycogen phosphorylase, muscle form Antibody (3D8) [H00005837-M02] - Detection limit for recombinant GST tagged PYGM is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Glycogen phosphorylase, muscle form Antibody (3D8) Summary

Immunogen
PYGM (NP_005600.1 734 a.a. - 842 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEAI
Specificity
PYGM - phosphorylase, glycogen; muscle (McArdle syndrome, glycogen storage disease type V) (3D8)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PYGM
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glycogen phosphorylase, muscle form Antibody (3D8)

  • EC 2.4.1.1
  • glycogen phosphorylase, muscle form
  • myophosphorylase
  • phosphorylase, glycogen, muscle
  • phosphorylase, glycogen; muscle

Background

Glycogen phosphorylase (EC 2.4.1.1) catalyzes and regulates the breakdown of glycogen to glucose-1-phosphate.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-215
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-69295
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP1-55090
Species: Hu
Applications: WB, IHC, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-14290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-84256
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01142
Species: Hu, Mu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001376-B01P
Species: Hu
Applications: WB
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P

Publications for Glycogen phosphorylase, muscle form Antibody (H00005837-M02) (0)

There are no publications for Glycogen phosphorylase, muscle form Antibody (H00005837-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glycogen phosphorylase, muscle form Antibody (H00005837-M02) (0)

There are no reviews for Glycogen phosphorylase, muscle form Antibody (H00005837-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glycogen phosphorylase, muscle form Antibody (H00005837-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glycogen phosphorylase, muscle form Products

Bioinformatics Tool for Glycogen phosphorylase, muscle form Antibody (H00005837-M02)

Discover related pathways, diseases and genes to Glycogen phosphorylase, muscle form Antibody (H00005837-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycogen phosphorylase, muscle form Antibody (H00005837-M02)

Discover more about diseases related to Glycogen phosphorylase, muscle form Antibody (H00005837-M02).
 

Pathways for Glycogen phosphorylase, muscle form Antibody (H00005837-M02)

View related products by pathway.

PTMs for Glycogen phosphorylase, muscle form Antibody (H00005837-M02)

Learn more about PTMs related to Glycogen phosphorylase, muscle form Antibody (H00005837-M02).
 

Research Areas for Glycogen phosphorylase, muscle form Antibody (H00005837-M02)

Find related products by research area.

Blogs on Glycogen phosphorylase, muscle form

There are no specific blogs for Glycogen phosphorylase, muscle form, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glycogen phosphorylase, muscle form Antibody (3D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol PYGM
Entrez
Uniprot