Recombinant Human Glutathione S-Transferase pi 1/GSTP1 Protein

Product Discontinued

Recombinant Human Glutathione S-Transferase pi 1/GSTP1 Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-210 of Human GSTP1 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPEFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Protein/Peptide Type: Recombinant Protein
• Gene: GSTP1

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Glutathione S-Transferase pi 1/GSTP1 Protein

• deafness, X-linked 7
• DFN7
• EC 2.5.1.18
• FAEES3
• fatty acid ethyl ester synthase III
• glutathione S-transferase P
• Glutathione STransferase pi 1
• Glutathione S-Transferase pi 1
• GST class-pi
• GST3DFN7
• GSTP
• GSTP1
• GSTP1-1
• PI

Background

Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. The glutathione S-transferase pi gene (GSTP1) is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Glutathione S-Transferase pi 1/GSTP1 Recombinant Protein (H00002950-P01)(2)

Publications using H00002950-P01

• Andrukhova O, Salama M, Krssak M et al. Single dose GSTP1 prevents infarction-induced heart failure. J Card Fail 2014-01-09 [PMID: 24412522]
• Yang Z, Chevolot Y, Gehin T et al. Improvement of protein immobilization for the elaboration of tumor-associated antigen microarrays: Application to the sensitive and specific detection of tumor markers from breast cancer sera. Biosens Bioelectron 2012-09-29 [PMID: 23017679]

Bioinformatics

• Gene Symbol: GSTP1