Glutathione Peroxidase 3/GPX3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Glutathione Peroxidase 3/GPX3 Antibody - BSA Free (NBP2-82233) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GPX3. Peptide sequence: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GPX3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
| Theoretical MW |
25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Glutathione Peroxidase 3/GPX3 Antibody - BSA Free
Background
Glutathione Peroxidase 3 (GPX3) belongs to the glutathione peroxidase family. It protects cells and enzymes from oxidative damage by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide by glutathione. There is increasing evidence that GPX3 is a novel tumor suppressor and a therapeutic target for insulin resistance and diabetes mellitus.
GPX-3 antibodies are useful tools for research on cellular response to oxidative stress as well as cancer and diabetes studies.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: EM, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Publications for Glutathione Peroxidase 3/GPX3 Antibody (NBP2-82233) (0)
There are no publications for Glutathione Peroxidase 3/GPX3 Antibody (NBP2-82233).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glutathione Peroxidase 3/GPX3 Antibody (NBP2-82233) (0)
There are no reviews for Glutathione Peroxidase 3/GPX3 Antibody (NBP2-82233).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Glutathione Peroxidase 3/GPX3 Antibody (NBP2-82233) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glutathione Peroxidase 3/GPX3 Products
Research Areas for Glutathione Peroxidase 3/GPX3 Antibody (NBP2-82233)
Find related products by research area.
|
Blogs on Glutathione Peroxidase 3/GPX3