Glutathione Peroxidase 3/GPX3 Antibody - BSA Free

Western Blot: Glutathione Peroxidase 3/GPX3 Antibody [NBP2-82233] - WB Suggested Anti-GPX3 Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysateGPX3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Immunohistochemistry-Paraffin: Glutathione Peroxidase 3/GPX3 Antibody [NBP2-82233] - Rabbit Anti-GPX3 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue. Observed Staining: Membrane and cytoplasmic in alveolar type I & II cells. Primary Antibody Concentration: 1:100. Other Working Concentrations: 1/600. Secondary Antibod

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Glutathione Peroxidase 3/GPX3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Glutathione Peroxidase 3/GPX3 Antibody - BSA Free (NBP2-82233) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GPX3. Peptide sequence: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPX3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Glutathione Peroxidase 3/GPX3 Antibody - BSA Free

• EC 1.11.1
• EC 1.11.1.9
• Extracellular glutathione peroxidase
• glutathione peroxidase 3 (plasma)
• Glutathione Peroxidase 3
• GPX3
• GPx-3
• GPXP
• GPX-P
• GSHPx-3
• GSHPx-P
• Plasma glutathione peroxidase

Background

Glutathione Peroxidase 3 (GPX3) belongs to the glutathione peroxidase family. It protects cells and enzymes from oxidative damage by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide by glutathione. There is increasing evidence that GPX3 is a novel tumor suppressor and a therapeutic target for insulin resistance and diabetes mellitus.

GPX-3 antibodies are useful tools for research on cellular response to oxidative stress as well as cancer and diabetes studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPX3