GLRB Recombinant Protein Antigen

Images

 
There are currently no images for GLRB Protein (NBP2-30683PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GLRB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLRB.

Source: E. coli

Amino Acid Sequence: MLNNPKRVEAEKARIAKAEQADGKGGNVAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GLRB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30683.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GLRB Recombinant Protein Antigen

  • beta subunit
  • Glycine receptor 58 kDa subunit
  • glycine receptor, beta

Background

GLRB, also known as Glycine receptor subunit beta, has a 497 amino acid long isoform that is 56 kDa and a short 303 amino acid isoform that is 35 kDa, composed of alpha and beta subunits, responsible for mediating the inhibitory effects of glycine functioning as a neurotransmitter-gated ion channel which produces hyperpolarization via increased chloride conductance due to the binding of glycine to the receptor. Current research is being performed on several diseases and disorders including hyperekplexia, stiff-person syndrome, neurological disorder, autosomal recessive, startle disease, idiopathic generalized epilepsy, spasticity, pharyngitis, neuronitis, and lung cancer. This protein has also been shown to have interactions with GPHN and PFN1 in pathways such as neurophysiological process PGE2-induced pain processing, ligand-gated ion channel transport, transmembrane transport of small molecules, ion channel transport, and neuroactive ligand-receptor interaction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-113
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IP, WB
NBP2-03449
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-86653
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB7848
Species: Hu
Applications: IHC, WB
NBP3-46222
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP3-12251
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF640
Species: Mu
Applications: IHC, WB
H00008001-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-75510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-59008
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB100-757
Species: Hu
Applications: ChIP, IHC,  IHC-P, WB
NB100-1538
Species: Ha, Hu, Rt
Applications: IHC,  IHC-P, IP, PEP-ELISA, WB
NBP1-90003
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-30683PEP
Species: Hu
Applications: AC

Publications for GLRB Protein (NBP2-30683PEP) (0)

There are no publications for GLRB Protein (NBP2-30683PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLRB Protein (NBP2-30683PEP) (0)

There are no reviews for GLRB Protein (NBP2-30683PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GLRB Protein (NBP2-30683PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GLRB Products

Array NBP2-30683PEP

Research Areas for GLRB Protein (NBP2-30683PEP)

Find related products by research area.

Blogs on GLRB

There are no specific blogs for GLRB, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GLRB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GLRB