GLRB Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLRB. Source: E. coli
Amino Acid Sequence: MLNNPKRVEAEKARIAKAEQADGKGGNVAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
GLRB |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30683. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for GLRB Recombinant Protein Antigen
Background
GLRB, also known as Glycine receptor subunit beta, has a 497 amino acid long isoform that is 56 kDa and a short 303 amino acid isoform that is 35 kDa, composed of alpha and beta subunits, responsible for mediating the inhibitory effects of glycine functioning as a neurotransmitter-gated ion channel which produces hyperpolarization via increased chloride conductance due to the binding of glycine to the receptor. Current research is being performed on several diseases and disorders including hyperekplexia, stiff-person syndrome, neurological disorder, autosomal recessive, startle disease, idiopathic generalized epilepsy, spasticity, pharyngitis, neuronitis, and lung cancer. This protein has also been shown to have interactions with GPHN and PFN1 in pathways such as neurophysiological process PGE2-induced pain processing, ligand-gated ion channel transport, transmembrane transport of small molecules, ion channel transport, and neuroactive ligand-receptor interaction.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Ha, Hu, Rt
Applications: IHC, IHC-P, IP, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: AC
Publications for GLRB Protein (NBP2-30683PEP) (0)
There are no publications for GLRB Protein (NBP2-30683PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GLRB Protein (NBP2-30683PEP) (0)
There are no reviews for GLRB Protein (NBP2-30683PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for GLRB Protein (NBP2-30683PEP) (0)
Additional GLRB Products
Research Areas for GLRB Protein (NBP2-30683PEP)
Find related products by research area.
|
Blogs on GLRB