GHDC Recombinant Protein Antigen

Images

 
There are currently no images for GHDC Protein (NBP1-81309PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GHDC Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GHDC.

Source: E.coli

Amino Acid Sequence: SAPHYEVFVALRGLRNLSEENRDKLDHCLQEASPRYKSLRFWGSVGPARVHLVGQGAFRALRAALAACPSSPFPPAMPRVLRHRHLAQCL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GHDC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81309.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GHDC Recombinant Protein Antigen

  • D11LGP1E
  • GH3 domain containing
  • GH3 domain-containing protein
  • homolog of mouse LGP1
  • LGP1D11LGP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NBP1-85348
Species: Hu
Applications: WB, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF347
Species: Hu
Applications: WB, IHC, Neut
H00023263-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP2-46439
Species: Hu
Applications: WB, IHC
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008361-R01
Species: Hu
H00008360-R01
Species: Hu

Publications for GHDC Protein (NBP1-81309PEP) (0)

There are no publications for GHDC Protein (NBP1-81309PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GHDC Protein (NBP1-81309PEP) (0)

There are no reviews for GHDC Protein (NBP1-81309PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for GHDC Protein (NBP1-81309PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GHDC Products

Bioinformatics Tool for GHDC Protein (NBP1-81309PEP)

Discover related pathways, diseases and genes to GHDC Protein (NBP1-81309PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GHDC Protein (NBP1-81309PEP)

Discover more about diseases related to GHDC Protein (NBP1-81309PEP).

Blogs on GHDC

There are no specific blogs for GHDC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GHDC Antibody
NBP1-81309
GHDC Antibody
NBP1-81309

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GHDC Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GHDC