Recombinant Human GGTLC1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GGTLC1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 225 of Human GGTLA4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GGTLC1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GGTLC1 Protein

  • dJ831C21.1
  • dJ831C21.2
  • EC 2.3.2.2
  • gamma-glutamyl transpeptidase
  • gamma-glutamyltransferase light chain 1
  • gamma-glutamyltransferase-like activity 3
  • Gamma-glutamyltransferase-like activity 4GGTLA3
  • Gamma-glutamyltransferase-like protein 6
  • GGTL6
  • GGTLA4MGC50550

Background

This gene encodes a member of the gamma-glutamyl transpeptidase (GGT) family, which are important in the metabolism of glutathione. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translationally processed to form a heavy and a light chain. In contrast, the product of this gene only contains homology to the light chain region, and lacks a transmembrane domain. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP2-54724
Species: Hu
Applications: WB, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-80533
Species: Mu
Applications: WB
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00092086-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for GGTLC1 Recombinant Protein (H00092086-P01) (0)

There are no publications for GGTLC1 Recombinant Protein (H00092086-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GGTLC1 Recombinant Protein (H00092086-P01) (0)

There are no reviews for GGTLC1 Recombinant Protein (H00092086-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GGTLC1 Recombinant Protein (H00092086-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GGTLC1 Products

Bioinformatics Tool for GGTLC1 Recombinant Protein (H00092086-P01)

Discover related pathways, diseases and genes to GGTLC1 Recombinant Protein (H00092086-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GGTLC1 Recombinant Protein (H00092086-P01)

Discover more about diseases related to GGTLC1 Recombinant Protein (H00092086-P01).

Blogs on GGTLC1

There are no specific blogs for GGTLC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532
GGTLC1 Antibody
NBP1-56928

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GGTLC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GGTLC1