GFM1 Recombinant Protein Antigen

Images

 
There are currently no images for GFM1 Recombinant Protein Antigen (NBP2-55712PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GFM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GFM1.

Source: E. coli

Amino Acid Sequence: NKLDRMGSNPARALQQMRSKLNHNAAFMQIPMGLEGNFKGIVDLIEERAIYFDGDFGQIVRYGEIPAELRAAATDHRQELIECVANSDEQLGEMFLE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GFM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55712.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GFM1 Recombinant Protein Antigen

  • EFG
  • EFG1FLJ12662
  • EFGM
  • EF-Gmt
  • EGF1
  • FLJ13632
  • FLJ20773
  • G elongation factor, mitochondrial 1
  • G translation elongation factor, mitochondrial
  • GFMCOXPD1
  • hEFG1
  • mEF-G 1
  • mitochondrial elongation factor G
  • mitochondrial elongation factor G1
  • mitochondrial

Background

The GFM1 gene codes for a mitochondrial translation elongation factor G where one isoform is 751 amino acids long at around 83 kDA and another isoform is 770 amino acids in length at around 86 kDA. Mitochondrial translation is critical for maintaining mitochondrial function. Mutations may lead to a failure of the respiratory chain-oxidative phosphorylation system and maintenance of mitochondrial DNA will not be successful. GFM1 has been studied in relation to candidiasis, malaria, mycobacterium tuberculosis, hemophilia B, pneumonia, and combined oxidative phosphorylation deficiency. It interacts with TRIM63, SLX4, PRPF4, TRIM55, and SMURF2 to participate in protein biosynthesis and polypeptide chain elongation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

236-EG
Species: Hu
Applications: BA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-33320
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
2914-HT
Species: Hu
Applications: BA
NBP1-47863
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89796
Species: Hu, Mu
Applications: IHC,  IHC-P
NBP3-04894
Species: Hu
Applications: ELISA, IHC,  IHC-P, KO, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-36751
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-83408
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF6796
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-55712PEP
Species: Hu
Applications: AC

Publications for GFM1 Recombinant Protein Antigen (NBP2-55712PEP) (0)

There are no publications for GFM1 Recombinant Protein Antigen (NBP2-55712PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GFM1 Recombinant Protein Antigen (NBP2-55712PEP) (0)

There are no reviews for GFM1 Recombinant Protein Antigen (NBP2-55712PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GFM1 Recombinant Protein Antigen (NBP2-55712PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GFM1 Products

Blogs on GFM1

There are no specific blogs for GFM1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GFM1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GFM1