We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Gephyrin/GPHN Recombinant Protein Antigen

Images

 
There are currently no images for Gephyrin/GPHN Protein (NBP1-87876PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Gephyrin/GPHN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPHN.

Source: E. coli

Amino Acid Sequence: SRCSSKENILRASHSAVDITKVARRHRMSPFPLTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGEQPTQTVMPGQVMRVTTGAPIPCGADAVVQVEDT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPHN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87876.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Gephyrin/GPHN Recombinant Protein Antigen

  • GEPH
  • Gephyrin
  • GPH
  • GPHN
  • GPHRYN
  • KIAA1385GPHGEPH

Background

The Gephyrin (GPHN) gene encodes a neuronal assembly protein that exists in isoform 1 (736 amino acids long, 79 kDA) or isoform 2 (769 amino acids in length, approximately 83 kDA). This protein anchors inhibitory neurotransmitter receptors to the postsynaptic cytoskeleton through high affinity binding to a receptor subunit domain and tublin dimers. The protein coded by GPHN is also necessary for molybdenum biosynthesis. The GPHN gene has been investigated in relation to many diseases such as leukemia, cervicitis, tuberculosis, alzheimer's disease, anorexia nervosa, huntington's disease, retinitis, and herpes zoster. The GPHN gene interacts with genes DYNLL1, PFN1, PRPF4, ENAH, and SLX4 to participate in pathways that regulate metabolism of vitamins and cofactors as well as molybdenum cofactor biosynthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7848
Species: Hu
Applications: IHC, WB
NBP2-20857
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF2086
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-00220
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
NBP2-86653
Species: Hu
Applications: IHC,  IHC-P, WB
NB110-41528
Species: Ha, Hu, Pm, Mu, Po, Rt
Applications: IHC,  IHC-P, In vitro, MiAr, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-71771
Species: Dr, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-61774
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP1-81045
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86988
Species: Hu, Mu
Applications: IHC,  IHC-P
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-92130
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-32423
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-50028
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, WB

Publications for Gephyrin/GPHN Protein (NBP1-87876PEP) (0)

There are no publications for Gephyrin/GPHN Protein (NBP1-87876PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gephyrin/GPHN Protein (NBP1-87876PEP) (0)

There are no reviews for Gephyrin/GPHN Protein (NBP1-87876PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Gephyrin/GPHN Protein (NBP1-87876PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gephyrin/GPHN Products

Research Areas for Gephyrin/GPHN Protein (NBP1-87876PEP)

Find related products by research area.

Blogs on Gephyrin/GPHN

There are no specific blogs for Gephyrin/GPHN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Gephyrin/GPHN Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GPHN