Recombinant Human Gephyrin/GPHN Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Gephyrin/GPHN Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 677-769 of Human GPHN partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RKMQGILDPRPTIIKARLSCDVKLDPRPEYHRCILTWHHQEPLPWAQSTGNQMSSRLMSMRSANGLLMLPPKTEQYVELHKGEVVDVMVIGRL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GPHN

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Gephyrin/GPHN Protein

  • GEPH
  • Gephyrin
  • GPH
  • GPHN
  • GPHRYN
  • KIAA1385GPHGEPH

Background

GPHN - gephyrin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7848
Species: Hu
Applications: WB, IHC
NBP2-46628
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-41299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-71771
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30683
Species: Hu
Applications: IHC, IHC-P
NBP1-81045
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-113
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-92130
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-32423
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
H00010243-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Gephyrin/GPHN Partial Recombinant Protein (H00010243-Q01) (0)

There are no publications for Gephyrin/GPHN Partial Recombinant Protein (H00010243-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gephyrin/GPHN Partial Recombinant Protein (H00010243-Q01) (0)

There are no reviews for Gephyrin/GPHN Partial Recombinant Protein (H00010243-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gephyrin/GPHN Partial Recombinant Protein (H00010243-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gephyrin/GPHN Products

Bioinformatics Tool for Gephyrin/GPHN Partial Recombinant Protein (H00010243-Q01)

Discover related pathways, diseases and genes to Gephyrin/GPHN Partial Recombinant Protein (H00010243-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gephyrin/GPHN Partial Recombinant Protein (H00010243-Q01)

Discover more about diseases related to Gephyrin/GPHN Partial Recombinant Protein (H00010243-Q01).
 

Pathways for Gephyrin/GPHN Partial Recombinant Protein (H00010243-Q01)

View related products by pathway.

Blogs on Gephyrin/GPHN

There are no specific blogs for Gephyrin/GPHN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Gephyrin/GPHN Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPHN
Entrez