GCAP1 Antibody (2F7)

Images

 
Western Blot: GCAP1 Antibody (2F7) [H00002978-M04] - Analysis of GUCA1A expression in transfected 293T cell line by GUCA1A monoclonal antibody (M04), clone 2F7. Lane 1: GUCA1A transfected lysatE (22.9 KDa). Lane 2: ...read more
Western Blot: GCAP1 Antibody (2F7) [H00002978-M04] - Western blot analysis of GUCA1A over-expressed 293 cell line, cotransfected with GUCA1A Validated Chimera RNAi or non-transfected control. Blot probed with ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi
Clone
2F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GCAP1 Antibody (2F7) Summary

Immunogen
GUCA1A (NP_000400, 1 a.a. - 93 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLR
Specificity
GUCA1A (2F7)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GUCA1A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA and RNAi Validation.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GCAP1 Antibody (2F7)

  • C6orf131
  • chromosome 6 open reading frame 131
  • CORD14
  • GCAP 1
  • GCAP1photoreceptor 1
  • GCAPGUCA
  • guanylate cyclase activator 1A (retina)
  • Guanylate cyclase activator 1A
  • guanylin 1, retina
  • guanylyl cyclase-activating protein 1
  • GUCA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-5422
Species: Bv
Applications: WB, ELISA, IHC, IHC-P
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-08197
Species: Hu
NBP1-84880
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24535
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00009626-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
AF6386
Species: Hu
Applications: WB, IP
NBP1-84996
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000251-M07
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBL1-12154
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89724
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-16053
Species: Hu
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
H00002978-M04
Species: Hu
Applications: WB, ELISA, RNAi

Publications for GCAP1 Antibody (H00002978-M04) (0)

There are no publications for GCAP1 Antibody (H00002978-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCAP1 Antibody (H00002978-M04) (0)

There are no reviews for GCAP1 Antibody (H00002978-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GCAP1 Antibody (H00002978-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCAP1 Products

Bioinformatics Tool for GCAP1 Antibody (H00002978-M04)

Discover related pathways, diseases and genes to GCAP1 Antibody (H00002978-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCAP1 Antibody (H00002978-M04)

Discover more about diseases related to GCAP1 Antibody (H00002978-M04).
 

Pathways for GCAP1 Antibody (H00002978-M04)

View related products by pathway.

PTMs for GCAP1 Antibody (H00002978-M04)

Learn more about PTMs related to GCAP1 Antibody (H00002978-M04).
 

Research Areas for GCAP1 Antibody (H00002978-M04)

Find related products by research area.

Blogs on GCAP1

There are no specific blogs for GCAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCAP1 Antibody (2F7) and receive a gift card or discount.

Bioinformatics

Gene Symbol GUCA1A
Entrez
OMIM
Uniprot