GBP1 Antibody (3X7O9)

Western Blot: GBP1 Antibody (3X7O9) [NBP3-15278] - Western blot analysis of extracts of various cell lines, using GBP1 antibody (NBP3-15278) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunohistochemistry-Paraffin: GBP1 Antibody (3X7O9) [NBP3-15278] - Immunohistochemistry of paraffin-embedded human lung cancer using GBP1 Rabbit mAb (NBP3-15278) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clone: 3X7O9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

GBP1 Antibody (3X7O9) Summary

• Description: Novus Biologicals Rabbit GBP1 Antibody (3X7O9) (NBP3-15278) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 493-592 of human GBP1 (P32455). RVKAESAQASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRRRKACTIS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: GBP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GBP1 Antibody (3X7O9)

• GBP-1
• GTP-binding protein 1
• Guanine nucleotide-binding protein 1
• guanylate binding protein 1, interferon-inducible
• guanylate binding protein 1, interferon-inducible, 67kDa
• huGBP-1
• interferon-induced guanylate-binding protein 1

Background

Guanylate binding protein expression is induced by interferon. Guanylate binding proteins are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP) and are distinguished from the GTP-binding proteins by the presence of 2 binding motifs rather than 3. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GBP1