Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA |
Clone | 1F5 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | C21orf33 (NP_004640, 188 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK |
Specificity | C21orf33 - chromosome 21 open reading frame 33 |
Isotype | IgG1 Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | C21ORF33 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Diseases for GATD3A Antibody (H00008209-M01)Discover more about diseases related to GATD3A Antibody (H00008209-M01).
| Pathways for GATD3A Antibody (H00008209-M01)View related products by pathway.
|
PTMs for GATD3A Antibody (H00008209-M01)Learn more about PTMs related to GATD3A Antibody (H00008209-M01).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.