Home » GATD3A » GATD3A Antibodies » GATD3A Antibody (1F5)

GATD3A Antibody (1F5)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: C21orf33 Antibody (1F5) [H00008209-M01] - C21orf33 monoclonal antibody (M01), clone 1F5 Analysis of C21orf33 expression in HeLa.
Western Blot: C21orf33 Antibody (1F5) [H00008209-M01] - C21orf33 monoclonal antibody (M01), clone 1F5 Analysis of C21orf33 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Western Blot: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of C21orf33 expression in transfected 293T cell line by C21orf33 monoclonal antibody (M01), clone 1F5.Lane 1: C21orf33 transfected lysate(28.1 KDa).Lane ...read more
Sandwich ELISA: C21orf33 Antibody (1F5) [H00008209-M01] - Detection limit for recombinant GST tagged C21orf33 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
1F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

GATD3A Antibody (1F5) Summary

Immunogen
C21orf33 (NP_004640, 188 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
Specificity
C21orf33 - chromosome 21 open reading frame 33
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
C21ORF33
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GATD3A Antibody (1F5)

  • chromosome 21 open reading frame 33
  • D21S2048E
  • ES1
  • GT335
  • HES1
  • HES1KNP-Ia
  • human HES1 protein, homolog to E.coli and zebrafish ES1 protein, 10Protein GT335
  • Keio novel protein I
  • KNPH
  • KNPI
  • KNP-I
  • KNPImitochondrial
  • Protein KNP-I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Notch-1 Antibody
(mN1A) - BSA Free
NB100-78486
Immunohistochemistry-Paraffin: Notch-1 Antibody (mN1A) [NB100-78486] - Analysis of FFPE human pancreatic cancer using 1:10 dilution of Notch-1 antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) was performed using Aperio AT2 (Leica Biosystems). Cytoplasmic staining in epithelial cells was observed. Staining was performed by Histowiz.
Knockout Validated: Notch-1 Antibody (mN1A) [NB100-78486] - Lysates of HeLa human cervical epithelial carcinoma parental cell line and Notch-1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/mL of Mouse Anti-Human Notch-1 Monoclonal Antibody (Catalog # NB100-78486) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for Notch-1 at approximately 110 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Flow Cytometry: Notch-1 Antibody (mN1A) [NB100-78486] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and MCF-7 (B) cells using Notch1 antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Reviews)
(8 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
HES5 Antibody -
BSA Free
NBP2-41305
Immunocytochemistry/Immunofluorescence: HES5 Antibody [NBP2-41305] - Staining of HES5 in mouse brain tissue with at 20 ug/mL.
Western Blot: HES5 Antibody [NBP2-41305] - Western blot analysis of HES5 in Raji cell lysate with HES5 antibody at 1 ug/ml (A) the absence and (B) the presence of blocking peptide.
Immunohistochemistry-Paraffin: HES5 Antibody [NBP2-41305] - Human spleen tissue with HES5 antibody at 5 ug/ml.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ASCL1/Mash1
Antibody [Unconjugate
AF2567
ASCL1/Mash1 was detected in immersion fixed paraffin-embedded sections of mouse embryo (13 d.p.c., cross-section through developing CNS) using Goat Anti-Mouse ASCL1/Mash1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2567) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell nuclei. Staining was performed using our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(2 Reviews)
(2 Publications)
Species: Mu
Applications: IHC, WB
csl/RBPJK Antibody
NBP1-33427
Chromatin Immunoprecipitation (ChIP): csl/RBPJK Antibody [NBP1-33427] - Sheared, cross-linked chromatin was prepared from Jurkat T-ALL cells using the Covaris TruChIP kit and shearing with the LE220 sonicator. The chromatin buffer was adjusted to 150 mM NaCl, 20 mM Tris-Cl pH 8, 2 mM EDTA, and 1% Triton X-100. Three antibodies, as well as pure pre-immune rabbit IgG control, were added to each IP reaction, consisting of 7 million cells, and incubated overnight with mixing at 4 C. The antibodies were captured with Magna ChIP Protein A+G beads (Millipore), washed with three wash buffers, and the DNA eluted and purified with the iPure v2 kit (Diagenode). The purified DNA was normalized to the input control with qPCR quantification of the insulin exon 1 gene (INS) and an RBPJ binding site in the promoter of HES1. Image from verified customer review.
Western Blot: csl/RBPJK Antibody [NBP1-33427] - Sample (30 ug of whole cell lysate) A: Jurkat 7.5% SDS PAGE diluted at 1:2000
Immunocytochemistry/Immunofluorescence: csl/RBPJK Antibody [NBP1-33427] - Analysis of paraformaldehyde-fixed HeLa at 1:100 dilution.
(1 Review)
Species: Hu
Applications: ChIP, ICC/IF, WB
Notch-4 Antibody -
BSA Free
NB100-93551
Immunocytochemistry/Immunofluorescence: Notch-4 Antibody [NB100-93551] - Notch-4 antibody (1:500) was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 20x.
Immunohistochemistry-Paraffin: Notch-4 Antibody [NB100-93551] - Analysis of Notch-4 in human intestine.
Western Blot: Notch-4 Antibody [NB100-93551] - Analysis of Notch-4 in 1. Jurkat 2. U937 3. WEHI 4. Raw267 cell lysates.
(3 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Notch-2 Antibody
AF1190
Notch‑2 was detected in perfusion fixed frozen sections of rat brain (choroid plexus) using 5 µg/mL Goat Anti-Rat Notch‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1190) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Notch‑2 was detected in immersion fixed frozen sections of embryonic rat liver (15 d.p.c.) using 1.7 µg/mL Goat Anti-Rat Notch‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1190) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
HEY1 Antibody
NBP2-16818
Western Blot: HEY1 Antibody [NBP2-16818] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HEY1 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Frozen: HEY1 Antibody [NBP2-16818] - Hey1 staining on E11.5 mouse Pharyngeal Mesoderm. Fixed 4% PFA overnight. Blocked with 1% BSA. Primary antibody dilution at 1:100. Secondary antibody at 1:1000, conjugated to Alexa Fluor 488. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: HEY1 Antibody [NBP2-16818] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: HEY1 protein stained by HEY1 antibody diluted at 1:2000. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody [114] diluted at 1:1000. Blue: Hoechst 33342 staining.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, WB
DGCR14 Antibody
NBP1-84257
Immunohistochemistry-Paraffin: DGCR14 Antibody [NBP1-84257] - Staining of human cerebral cortex, colon, liver and testis using Anti-DGCR14 antibody NBP1-84257 (A) shows similar protein distribution across tissues to independent antibody NBP1-84258 (B).
Immunohistochemistry-Paraffin: DGCR14 Antibody [NBP1-84257] - Staining of human colon.
Immunohistochemistry-Paraffin: DGCR14 Antibody [NBP1-84257] - Staining of human testis.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(15 Publications)
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
RRBP1 Antibody
NBP1-83957
Immunocytochemistry/Immunofluorescence: RRBP1 Antibody [NBP1-83957] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RRBP1 Antibody [NBP1-83957] - Analysis in human placenta and skeletal muscle tissues. Corresponding RRBP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RRBP1 Antibody [NBP1-83957] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Notch-3 Antibody
(1G5)
H00004854-M01
ELISA: Notch-3 Antibody (1G5) [H00004854-M01] - Detection limit for recombinant GST tagged NOTCH3 is approximately 0.03ng/ml as a capture antibody.
(1 Review)
(9 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Neurogenin-3
Antibody [Unconjugate
AF3444
Western blot shows lysates of human placenta and prostate tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Neurogenin‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3444) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Neurogenin‑3 at approximately 25 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(10 Publications)
Species: Hu
Applications: IHC, WB
GFAP Antibody
NB300-141
Immunohistochemistry: GFAP Antibody [NB300-141] - Analysis of a rat cerebellum section stained with rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green and mouse monoclonal antibody to MeCP2, dilution 1:500, in red. The blue is DAPI staining of nuclear DNA. Following transcardial perfusion of rat with 4% paraformaldehyde, brain was post fixed for 1 hour, cut to 45 uM, and free-floating sections were stained with above antibodies. The GFAP antibody stains the network of astrocytic cells and the processes of Bergmann glia in the molecular layer. The MeCP2 antibody specifically labels nuclei of certain neurons.
Western Blot: GFAP Antibody [NB300-141] - Analysis of different tissue lysates using rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord. Strong band at about 50 kDa corresponds to the major isotype of the GFAP protein. Smaller isotypes and proteolytic fragments of GFAP are also detected on the blot.
Western Blot: GFAP Antibody [NB300-141] - Analysis of Rat brain lysate. Antibody at 1:5000. Specific band running with an apparent SDS-PAGE molecular weight of ~50 kDa corresponds to rodent GFAP was observed.
(12 Reviews)
(81 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
HEY2 Antibody
NBP3-03905
Western Blot: HEY2 Antibody [NBP3-03905] - Analysis of extracts of various cell lines, using HEY2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.
Species: Hu, Mu, Rt
Applications: WB
Sonic Hedgehog/Shh
[Unconjugated]
1845-SH/CF
1 μg/lane of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus (Catalog #1845-SH/CF) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.1‑0.4 μg/mL.
MALDI-TOF analysis of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus. The major peak corresponds to the calculated molecular mass, 19814 Da. The minor peak at 20029  is a matrix-associated artifact of the MALDI-TOF.
(50 Publications)
Species: Hu
Applications: BA
MATH1 Antibody
NBP1-45693
Western Blot: MATH1 Antibody [NBP1-45693] - Analysis of Math 1 using Jurkat cell lysate.
Species: Hu, Mu, Rt
Applications: IHC, WB
DLL1 [Unconjugated]
5026-DL
DLL1 [Unconjugated]
(2 Reviews)
(12 Publications)
Species: Mu
Applications: BA
HESX1 Antibody
NBP1-89090
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts as well as in Leydig cells.
Species: Hu
Applications: IHC, IHC-P

Publications for GATD3A Antibody (H00008209-M01) (0)

There are no publications for GATD3A Antibody (H00008209-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATD3A Antibody (H00008209-M01) (0)

There are no reviews for GATD3A Antibody (H00008209-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GATD3A Antibody (H00008209-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GATD3A Products

Bioinformatics Tool for GATD3A Antibody (H00008209-M01)

Discover related pathways, diseases and genes to GATD3A Antibody (H00008209-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATD3A Antibody (H00008209-M01)

Discover more about diseases related to GATD3A Antibody (H00008209-M01).
 

Pathways for GATD3A Antibody (H00008209-M01)

View related products by pathway.

PTMs for GATD3A Antibody (H00008209-M01)

Learn more about PTMs related to GATD3A Antibody (H00008209-M01).

Blogs on GATD3A

There are no specific blogs for GATD3A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GATD3A Antibody (1F5) and receive a gift card or discount.


Bioinformatics

Gene Symbol C21ORF33
Entrez
OMIM
Uniprot