GATD3A Antibody (1F5) - Azide and BSA Free

Western Blot: C21orf33 Antibody (1F5) [H00008209-M01] - C21orf33 monoclonal antibody (M01), clone 1F5 Analysis of C21orf33 expression in HeLa.

Immunocytochemistry/Immunofluorescence: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on HeLa cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.

Western Blot: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of C21orf33 expression in transfected 293T cell line by C21orf33 monoclonal antibody (M01), clone 1F5.Lane 1: C21orf33 transfected lysate(28.1 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: C21orf33 Antibody (1F5) [H00008209-M01] - Detection limit for recombinant GST tagged C21orf33 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 1F5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GATD3A Antibody (1F5) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: C21orf33 (NP_004640, 188 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
• Specificity: C21orf33 - chromosome 21 open reading frame 33
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GATD3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GATD3A Antibody (1F5) - Azide and BSA Free

• chromosome 21 open reading frame 33
• D21S2048E
• ES1
• GT335
• HES1
• HES1KNP-Ia
• human HES1 protein, homolog to E.coli and zebrafish ES1 protein, 10Protein GT335
• Keio novel protein I
• KNPH
• KNPI
• KNP-I
• KNPImitochondrial
• Protein KNP-I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GATD3
• Entrez:
  • 8209(Human)
• OMIM:
  • 601659(Human)
• Uniprot:
  • NP_004640(Human)