GATD3A Antibody (1F5)

Images

 
Western Blot: C21orf33 Antibody (1F5) [H00008209-M01] - C21orf33 monoclonal antibody (M01), clone 1F5 Analysis of C21orf33 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Western Blot: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of C21orf33 expression in transfected 293T cell line by C21orf33 monoclonal antibody (M01), clone 1F5.Lane 1: C21orf33 transfected lysate(28.1 KDa).Lane ...read more
Sandwich ELISA: C21orf33 Antibody (1F5) [H00008209-M01] - Detection limit for recombinant GST tagged C21orf33 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
1F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GATD3A Antibody (1F5) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
C21orf33 (NP_004640, 188 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
Specificity
C21orf33 - chromosome 21 open reading frame 33
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
C21ORF33
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GATD3A Antibody (1F5)

  • chromosome 21 open reading frame 33
  • D21S2048E
  • ES1
  • GT335
  • HES1
  • HES1KNP-Ia
  • human HES1 protein, homolog to E.coli and zebrafish ES1 protein, 10Protein GT335
  • Keio novel protein I
  • KNPH
  • KNPI
  • KNP-I
  • KNPImitochondrial
  • Protein KNP-I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GATD3A Antibody (H00008209-M01) (0)

There are no publications for GATD3A Antibody (H00008209-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATD3A Antibody (H00008209-M01) (0)

There are no reviews for GATD3A Antibody (H00008209-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GATD3A Antibody (H00008209-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GATD3A Antibody (1F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol C21ORF33
Entrez
OMIM
Uniprot