Gasdermin D Antibody - BSA Free

Analysis in human cell lines U2OS and HEK293 using anti-GSDMD antibody. Corresponding GSDMD RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.

GSDMD from cell lysates of THP1 treated by staphylococcus aureus alpha toxin was detected by immunoblot using GSDMD antibody (NBP2-33422) at 2 ug/mL. WB image submitted by a verified customer review.

SFV4-induced cell death in HOS and A549 cells. Lysates were harvested from SFV4-infected HOS and A549 cells (MOI = 10) at 6, 24 and 48 h. Full-length GSDMDFL, truncated and active GSDMDN-term (lower band, indicated by arrow) and mature IL-1betamat were detected by Western blot. Vinculin was used as internal loading control. Autophagy: HOS and A549 cells expressing eGFP-LC3 cells were infected with SFV4 (MOI = 10) and monitored by fluorescence microscopy. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41419-020-2236-3), licensed under a CC-BY license.

Western Blot: GSDMDC1 Antibody [NBP2-33422] - miR-513c-5p negatively regulates caspase-1 expression in HUVECs. (A) The expression of miR-513c-5p after NC, miR-513c-5p mimics, INC & miR-513c-5p inhibitor transfection was evaluated by qRT-PCR. (B) The expression level of caspase-1 mRNA after NC, miR-513c-5p mimics, INC & miR-513c-5p inhibitor transfection was detected by qRT-PCR. (C,D) Expression of caspase-1 in HUVECs were detected after transfection NC, miR-513c-5p mimics, INC, miR-513c-5p inhibitor by immunofluorescence staining (magnification, ×40). Scale bar = 200 μm. (E,F) Protein expression levels of caspase-1 & GSDMD were examined by Western blot. (G) The expression of IL-1 beta & IL-18 was detected by ELISA. *p 0.05; *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Pyroptosis is occurred in mouse corneas of C. albicans keratitis. (A) RT-qPCR analysis of the mRNA levels of pyroptosis-associated genes (ASC/CASP1/GSDMD/IL-1 beta /IL-18) in mouse corneas at 0 (control), 1, 3, & 7 dpi (n = 3). (B,C) Western blot detecting pyroptosis-related proteins of ASC, cleaved CASP1, cleaved IL-1 beta , cleaved IL-18, F-GSDMD & N-GSDMD in mouse corneas at 0 (control), 1, 3, & 7 dpi (n = 3). (D) Double-immunofluorescence staining of CASP1 & TUNEL in C. albicans infected-corneas compared with mock-infected controls (n = 3; Scale bar = 20 μm; magnification 400×). CASP1: caspase-1; Clv-CASP1:cleaved CASP1; Clv-IL-1 beta :cleaved IL-1 beta ; Clv-IL-18:cleaved IL-18; F-GSDMD: p53 form of GSDMD; N-GSDMD: cleaved p30 form of GSDMD. All values are presented as mean ± SEM. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001 vs. control group. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: GSDMDC1 Antibody [NBP2-33422] - NLRP3 knockdown attenuates the pyroptosis in mouse C. albicans keratitis. (A–C) RT-qPCR analysis & western blot showing the mRNA & protein levels of pyroptosis-related molecules in C. albicans-infected corneas pretreated with Ad-GFP-shRNA & Ad-NLRP3- shRNA compared with mock controls (n = 3). (D) Immunofluorescence staining of ASC, CASP1 & GSDMD in C. albicans-infected corneas pretreated with Ad-GFP-shRNA & Ad-NLRP3- shRNA compared with mock controls (n = 3). (E) Double-immunofluorescence staining of CASP1 & TUNEL in the mice cornea of Ad-NLRP3-shRNA group compared with the Ad-GFP-shRNA group (n = 3). Scale bar = 20 μm; magnification 400×. FK: fungal keratitis. CASP1: caspase-1; Clv-CASP1:cleaved CASP1; Clv-IL-1 beta :cleaved IL-1 beta ; Clv-IL-18:cleaved IL-18; F-GSDMD: p53 form of GSDMD; N-GSDMD: cleaved p30 form of GSDMD. All values are presented as mean ± SEM. *p < 0.05; **p < 0.01; ***p < 0.001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Knockdown of miR-513c-5p promotes pyroptosis of VECs & DVT formation by increasing caspase-1. (A) The expression level of miR-513c-5p in vascular tissue was detected by qRT-PCR in DVT mice treated with INC, miR-513c-5p inhibitor, respectively. (B) Expression of miR-513c-5p in PBMCs was detected by qRT-PCR in DVT mice treated with INC, miR-513c-5p inhibitor, respectively. (C) Confocal microscopy images of miR-513c-5p expression in vascular tissues (miR-513c-5p, red; DAPI, blue) (magnification, ×200). Scale bars = 100 μm. (D) H&E staining of serial cross sections of inferior vena cava (IVC) from DVT mice treated with INC, miR-513c-5p inhibitor at 48 h (magnification, ×40). Scale bars = 500 μm. (E) Representative images of thrombi in each treatment group were detected by vascular ultrasound at 48 h post-operation. (F) Thrombus length & weight at 48 h post-operation in the different treatment groups (n = 15 in each group). (G) Caspase-1 mRNA level was determined by qRT-PCR in vascular tissue of each treatment group. (H) Caspase-1 & GSDMD protein levels were determined by Western blot in vascular tissue of DVT mice treated with INC, miR-513c-5p inhibitor. (I) IL-1 beta & IL-18 protein levels in vascular tissue were determined by ELISA in INC, miR-513c-5p inhibitor treated DVT mice models, respectively. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35445025), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Pyroptosis & IL-1 beta release is dependent on the B. pseudomallei T3SS-3.hMDMs were infected with B. pseudomallei (MOI 300) for 3h. (A & B) Cell death induction & intracellular bacterial burden were determined at 0 & 3h p.i. Shown are the median & interquartile range of at least three independent experiments with different donors performed in technical duplicates. (C) IL-1 beta secretion was determined 3h p.i. Data are presented as median & interquartile range of four independent experiments with different donors performed in duplicates. (D) Caspase-1 & gasdermin-D processing were investigated 3h p.i. Lysates were re-probed for beta -actin. For immunoblot analysis one representative experiment of at least three with different donors is shown. (E) Growth analysis of wt & delta bsaL was performed. Shown are mean values of three independent experiments performed in technical triplicates. (*p < 0.05, **p < 0.01). n.i. (not infected), wt (wild type), b.d. (below detection), hours (h), p.i. (post infection), GSDMD (gasdermin D). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33137811), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Priming is not required for NLRP3 inflammasome activation in human monocytes in vitro. (A, B) Undifferentiated THP-1 cells (n=6 independent biological replicates) & (C, D) primary CD14+ monocytes (n=6 independent biological replicates (each point represents a different blood donor)) were left untreated or primed with LPS (1 µg/ml, 4 h) prior to treatment with nigericin (10 µM, 45 min) to activate the NLRP3 inflammasome. (A, C) IL-1 beta & IL-18 were measured by ELISA & cell death was measured by LDH assay & shown as percentage relative to total cell death, mean ± S.D., *P < 0.05; **P < 0.01; ***P < 0.001; ns (non significant) using one-way ANOVA comparing all groups. (B, D) Western blot analysis for mIL-18 (18 kDa), pro-IL-18 (24 kDa), mIL-1 beta (17 kDa), pro-IL-1 beta (34 kDa), mCaspase-1 (20 kDa), pro-Caspase-1 (45 kDa), GSDMD full length (FL, 53 kDa), GSDMD N-terminus (NT, 31 kDa), UBE2L3 (17.9 kDa), NLRP3 (113 kDa), as well as loading control beta -actin (42 kDa). Blots are representative of at least 3 independent biological experiments & in case of monocytes 3 different blood donors. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33101286), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Heat-killed C. albicans (HKCA) activates NLRP3 inflammasome & induces pyroptosis in human corneal epithelial cells (HCECs). (A) The mRNA expression of NLRP3 in HCECs challenged with HKCA at an MOI of 1:500, 1:50, 1:5, 2:1, or 20:1 respectively for 4 hours was evaluated by RT-qPCR (n = 5). (B–D) The mRNA & protein expression of NLRP3 in HCECs exposed to HKCA (MOI = 20) for 0 (control), 2, 4, 8, 12, or 24 h (n = 3). (E) NLRP3 fluorescence intensity was evaluated using immunofluorescent staining for different times (12–36 h). (n = 3; Scale bar = 20 μm; magnification 400×). (F) Lactate dehydrogenase (LDH) of HCECs treated with HKCA (MOI = 20) for 24 h (n = 6). (G) The mRNA levels of ASC, CASP1, IL-1 beta , IL-18 & GSDMD in HCECs exposed to HKCA (MOI = 20) for different times (n = 3). (H,I) The protein expression of pyroptosis-related proteins (ASC, cleaved CASP1, N-GSDMD, cleaved IL-1 beta & cleaved IL-18) was examined by western blot (n = 3). CASP1: caspase-1; Clv-CASP1: cleaved CASP1; Clv-IL-1 beta : cleaved IL-1 beta ; Clv-IL-18: cleaved IL-18; N-GSDMD: cleaved p30 form of GSDMD. All values are presented as mean ± SEM. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001 vs. control group. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt, Po
• Applications: WB, Simple Western, ICC/IF, IHC, IP, KD, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Gasdermin D Antibody - BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit Gasdermin D Antibody - BSA Free (NBP2-33422) is a polyclonal antibody validated for use in IHC, WB, ICC/IF, Simple Western and IP. Anti-Gasdermin D Antibody: Cited in 94 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSDMD
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reactivity reported in scientific literature (PMID: 30250284).
  • Immunohistochemistry-Paraffin Reported in scientific literature (PMID:34494385).
  • Immunoprecipitation Reported in scientific literature (PMID :33053349).
  • Knockdown Validated Reactivity reported in scientific literature (PMID: 31216481)
  • Knockout Validated Reactivity reported in scientific literature (PMID: 32796818).
  • Simple Western 1:25
  • Western Blot 0.04 - 0.4 ug/mL
• Application Notes: See Simple Western Antibody Database for Simple Western validation: Tested in Human cells 1 mg/mL, separated by Size, antibody dilution of 1:25, apparent MW was 52 kDa
• Control Peptide:

  Gasdermin D Recombinant Protein Antigen (NBP2-33422PEP)

Reactivity Notes

Use in Porcine reported in scientific literature (PMID:34890644). Mouse reactivity reported in scientific literature (PMID: 30473634). Rat reactcivity reported in scientific literature (PMID: 32245616).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2), 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Gasdermin D Antibody - BSA Free

• DF5L
• DFNA5L
• gasdermin domain containing 1
• Gasdermin domain-containing protein 1
• gasdermin-D
• GSDMDC1

Background

Gasdermin D is a member of the gasdermin family. Members of this family appear to play a role in regulation of epithelial proliferation. Gasdermin D has been suggested to act as a tumor suppressor. Alternatively spliced transcript variants have been described. [provided by RefSeq, Oct 2009]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Gasdermin D Antibody (NBP2-33422)(97)

Publications using NBP2-33422

• Vind AC, Wu Z, Firdaus MJ et Al. The ribotoxic stress response drives acute inflammation, cell death, and epidermal thickening in UV-irradiated skin in vivo Mol Cell 2024-11-25 [PMID: 39591967]
• Sun Y, Pu Z, Zhao H et Al. Vitamin D can mitigate sepsis-associated neurodegeneration by inhibiting exogenous histone-induced pyroptosis and ferroptosis: Implications for brain protection and cognitive preservation Brain Behav Immun 2024-11-19 [PMID: 39566666]
• Yao J, Li Y, Liu X, Liang W et Al. FUBP3 mediates the amyloid-?-induced neuronal NLRP3 expression Neural Regen Res 2024-09-10 [PMID: 39254567]
• Fontana P, Du G, Zhang Y, Zhang H et Al. Small-molecule GSDMD agonism in tumors stimulates antitumor immunity without toxicity Cell 2024-09-07 [PMID: 39243763]
• Sun, Y;Lu, Y;Liu, L;Saaoud, F;Shao, Y;Xu, K;Drummer Iv, C;Cueto, R;Shan, H;Jiang, X;Zhao, H;Wang, H;Yang, X; Caspase-4/11 promotes hyperlipidemia and chronic kidney disease-accelerated vascular inflammation by enhancing trained immunity JCI insight 2024-07-18 [PMID: 39024553]
• Tsamouri LP, Hsiao JC, Wang Q, Geeson MB et Al. The hydrophobicity of the CARD8 N-terminus tunes inflammasome activation Cell Chem Biol 2024-07-11 [PMID: 38991619]
• Yiwen Wang, Yang Gao, Huairui Shi, Rifeng Gao, Ji’e Yang, Ya’nan Qu, Shiyu Hu, Jian Zhang, Jingpu Wang, Jiatian Cao, Feng Zhang, Junbo Ge CCL11 released by GSDMD-mediated macrophage pyroptosis regulates angiogenesis after hindlimb ischemia Cell Death Discovery 2024-06-21 [PMID: 38906863]
• Chaiheon Lee, Mingyu Park, W. C. Bhashini Wijesinghe, Seungjin Na, Chae Gyu Lee, Eunhye Hwang, Gwangsu Yoon, Jeong Kyeong Lee, Deok-Ho Roh, Yoon Hee Kwon, Jihyeon Yang, Sebastian A. Hughes, James E. Vince, Jeong Kon Seo, Duyoung Min, Tae-Hyuk Kwon Oxidative photocatalysis on membranes triggers non-canonical pyroptosis Nature Communications 2024-05-13 [PMID: 38740804]
• Wu A, Zhong C, Song X, Yuan W et Al. The activation of LBH-CRYAB signaling promotes cardiac protection against I/R injury by inhibiting apoptosis and ferroptosis iScience 2024-04-25 [PMID: 38660406]
• Zi G, Chen J, Peng Y et Al. Hyperthermia and cisplatin combination therapy promotes caspase-8 accumulation and activation to enhance apoptosis and pyroptosis in cancer cells Int J Hyperthermia 2024-04-19 [PMID: 38632954]
• Qiankun Wang, Kolin M Clark, Ritudhwaj Tiwari, Nagarajan Raju, Gregory K Tharp, Jeffrey Rogers, R Alan Harris, Muthuswamy Raveendran, Steven E Bosinger, Tricia H Burdo, Guido Silvestri, Liang Shan The CARD8 inflammasome dictates HIV/SIV pathogenesis and disease progression. Cell 2024-03-04 [PMID: 38428396]
• Cai H, Zhang J, Xu H et Al. ALOX5 drives the pyroptosis of CD4(+) T cells and tissue inflammation in rheumatoid arthritis Sci Signal 2024-02-29 [PMID: 38412254]
• Ting Zhan, Shanshan Tang, Junpei Du, Jingshuang Liu, Bodong Yu, Yuxin Yang, Yuting Xie, Yanting Qiu, Guodong Li, Yun Gao, Kota V. Ramana Implication of lncRNA MSTRG.81401 in Hippocampal Pyroptosis Induced by P2X7 Receptor in Type 2 Diabetic Rats with Neuropathic Pain Combined with Depression International Journal of Molecular Sciences 2024-01-18 [PMID: 38256257]
• Yu Q, Yang Y, Xu T et Al. Palmitoleic acid protects microglia from palmitate-induced neurotoxicity in vitro PLoS One 2024-01-19 [PMID: 38241239]
• Xing Ye, Jun-Yi Lin, Ling-Xia Chen, Xue-chun Wu, Kai-Jun Ma, Bei-Xu Li, You-Xin Fang SREBP1 deficiency diminishes glutamate-mediated HT22 cell damage and hippocampal neuronal pyroptosis induced by status epilepticus Heliyon 2023-12-18 [PMID: 38205297]
• Li Ran, Tao Ye, Eric Erbs, Stephan Ehl, Nathalie Spassky, Izabela Sumara, Zhirong Zhang, Romeo Ricci KCNN4 links PIEZO-dependent mechanotransduction to NLRP3 inflammasome activation. Science immunology 2023-12-25 [PMID: 38134241]
• Mohamed Ghait, Shivalee N. Duduskar, Michael Rooney, Norman Häfner, Laura Reng, Bianca Göhrig, Philipp A. Reuken, Frank Bloos, Michael Bauer, Christoph Sponholz, Tony Bruns, Ignacio Rubio The non-canonical inflammasome activators Caspase-4 and Caspase-5 are differentially regulated during immunosuppression-associated organ damage Frontiers in Immunology 2023-12-01 [PMID: 38106412]
• Ding N, Xiao H, Zhen L et al. Systemic cytokines inhibition with Imp7 siRNA nanoparticle ameliorates gut injury in a mouse model of ventilator-induced lung injury Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie 2023-07-27 [PMID: 37516020] (IHC-P, Mouse)
  
  Details:
  1:50 dilution
• Kim, D;Ban, KY;Lee, GH;Jun, HS; Lysophosphatidic Acid Induces Podocyte Pyroptosis in Diabetic Nephropathy by an Increase of Egr1 Expression via Downregulation of EzH2 International journal of molecular sciences 2023-06-09 [PMID: 37373116] (Western Blot)
• Yang Y, Yu Q, Li B et al. Palmitate lipotoxicity is closely associated with the fatty acid-albumin complexes in BV-2 microglia PloS one 2023-04-20 [PMID: 37079515] (ICC/IF, Mouse)
• Exconde PM, Hernandez-Chavez C, Bray MB et al. The tetrapeptide sequence of IL-1? regulates its recruitment and activation by inflammatory caspases bioRxiv : the preprint server for biology 2023-02-16 [PMID: 36824844] (WB, Mouse, Human)
• Wang Y, Pei S, Liu Z et al. IRAK-M suppresses the activation of microglial NLRP3 inflammasome and GSDMD-mediated pyroptosis through inhibiting IRAK1 phosphorylation during experimental autoimmune encephalomyelitis Cell death & disease 2023-02-10 [PMID: 36765034] (IHC, WB, Mouse)
• Hu R, Liang J, Ding L et al. Gasdermin D inhibition ameliorates neutrophil mediated brain damage in acute ischemic stroke Cell death discovery 2023-02-08 [PMID: 36755018] (IHC-P, Mouse)
  
  Details:
  Dilution used in WB 1:100
• Fan R, Jiang H, Hu Y et al. Stomatin-like protein-2 attenuates macrophage pyroptosis and H9c2 cells apoptosis by protecting mitochondrial function Biochemical and Biophysical Research Communications 2022-12-01 [PMID: 36332472] (WB, Rat)
  
  Details:
  Dilution used in WB 1:2000
• Sun B, Wu B, Wu D, et al. Allergen protease-induced Gsdmd p40 controls IL-33 secretion Research Square 2021-01-15
• Exconde, PM;Hernandez-Chavez, C;Bourne, CM;Richards, RM;Bray, MB;Lopez, JL;Srivastava, T;Egan, MS;Zhang, J;Yoo, W;Shin, S;Discher, BM;Taabazuing, CY; The tetrapeptide sequence of IL-18 and IL-1? regulates their recruitment and activation by inflammatory caspases Cell reports 2023-12-15 [PMID: 38103201]
• Luo M, Peng Y, Lv D et al. LncRNA GAS5 downregulates NLRP3 inflammasome activation-mediated pyroptosis in sepsis-induced myocardial injury by targeting SIRT3/AMPK? Heliyon 2023-12-01 [PMID: 38076153] (IHC-P, Mouse)
  
  Details:
  Mouse hearts: Dilution 1:200
• Pinilla M, Mazars R, Verg� R et al. EEF2-inactivating toxins engage the NLRP1 inflammasome and promote epithelial barrier disruption Journal of Experimental Medicine 2023-10-02 [PMID: 37642996] (Western Blot)
• Du G, Healy LB, David L et al. ROS-dependent palmitoylation is an obligate licensing modification for GSDMD pore formation bioRxiv : the preprint server for biology 2023-03-07 [PMID: 36945424] (WB, Human)
  
  Details:
  Dilutions: 1:1000
• Park E, Choi H, Truong CS, Jun HS The Inhibition of Autophagy and Pyroptosis by an Ethanol Extract of Nelumbo nucifera Leaf Contributes to the Amelioration of Dexamethasone-Induced Muscle Atrophy Nutrients 2023-02-04 [PMID: 36839161] (WB)
• Chen Q, Wang A, Covelli DJ et al. Optimized M24B Aminopeptidase Inhibitors for CARD8 Inflammasome Activation Journal of medicinal chemistry 2023-02-23 [PMID: 36724486]
• EL Orth-He, HC Huang, SD Rao, Q Wang, Q Chen, CM O'Mara, AJ Chui, M Saoi, AR Griswold, A Bhattachar, DP Ball, JR Cross, DA Bachovchin Protein folding stress potentiates NLRP1 and CARD8 inflammasome activation Cell Reports, 2023-01-16;0(0):111965. 2023-01-16 [PMID: 36649711]
• Qinghui Wang, Jeffrey C. Hsiao, Noah Yardeny, Hsin-Che Huang, Claire M. O’Mara, Elizabeth L. Orth-He et al. The NLRP1 and CARD8 inflammasomes detect reductive stress Cell Reports 2023-01-31 [PMID: 36649710] (Western Blot)
• Meyers AK, Wang Z, Han W et al. Pyruvate dehydrogenase kinase supports macrophage NLRP3 inflammasome activation during acute inflammation Cell Reports 2023-01-31 [PMID: 36640341] (Western Blot)
• Ball DP, Tsamouri LP, Wang AE et al. Oxidized thioredoxin-1 restrains the NLRP1 inflammasome Science immunology 2022-11-11 [PMID: 36332009] (WB, Human)
• Song Y, Guo F, Zhao YY et al. Novel lncRNA-prader willi/angelman region RNA, SNRPN neighbour (PWARSN) aggravates tubular epithelial cell pyroptosis by regulating TXNIP via dual way in diabetic kidney disease Cell proliferation 2022-10-31 [PMID: 36316968] (WB, Human)
• Hu R, Liang J, Ding L et al. Edaravone dexborneol provides neuroprotective benefits by suppressing NLRP3 inflammasome-induced microglial pyroptosis in experimental ischemic stroke International immunopharmacology 2022-10-21 [PMID: 36279668] (IHC-P, Mouse)
  
  Details:
  Dilution used in IHC 1:300
• Wang L, Yan H, Chen X et al. Caspase-8 is involved in pyroptosis, necroptosis and the maturation and release of IL-1B in Aspergillus fumigatus keratitis International immunopharmacology 2022-10-20 [PMID: 36274488] (IF/IHC, Mouse)
• Nadkarni R, Chu WC, Lee CQE et al. Viral proteases activate the CARD8 inflammasome in the human cardiovascular system Journal of Experimental Medicine 2022-10-03 [PMID: 36129453] (Western Blot)
• Buscetta M, Cristaldi M, Cimino M et al. Cigarette smoke promotes inflammasome-independent activation of caspase-1 and -4 leading to gasdermin D cleavage in human macrophages FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2022-09-01 [PMID: 36004615] (WB, Human)
• Luo M, Hu Y, Lv D et al. Recurrent Hypoglycemia Impaired Vascular Function in Advanced T2DM Rats by Inducing Pyroptosis Oxidative medicine and cellular longevity 2022-07-23 [PMID: 35915611] (WB, Rat)
  
  Details:
  WB Dilution: 1:1000, IHC Dilution: 1:200
• Chen W, Chen S, Yan C et al. Allergen protease-activated stress granule assembly and gasdermin D fragmentation control interleukin-33 secretion Nature immunology 2022-07-01 [PMID: 35794369]
• Fan L, Liu H, Zhu G et al. Caspase-4/11 is critical for angiogenesis by repressing Notch1 signaling via inhibiting gamma-secretase activity British journal of pharmacology 2022-06-23 [PMID: 35737588]
• Lin WY, Li LH, Hsiao YY et al. Repositioning of the Angiotensin II Receptor Antagonist Candesartan as an Anti-Inflammatory Agent With NLRP3 Inflammasome Inhibitory Activity Frontiers in Immunology 2022-05-20 [PMID: 35669789] (Western Blot)
• Hsiao JC, Neugroschl AR, Chui AJ et al. A ubiquitin-independent proteasome pathway controls activation of the CARD8 inflammasome Journal of Biological Chemistry 2022-07-01 [PMID: 35580636] (Western Blot)
• Lian H, Fang X, Li Q et al. NLRP3 Inflammasome-Mediated Pyroptosis Pathway Contributes to the Pathogenesis of Candida albicans Keratitis Frontiers in medicine 2022-04-06 [PMID: 35463001] (WB, Mouse)
• Chu C, Wang B, Zhang Z et al. miR-513c-5p Suppression Aggravates Pyroptosis of Endothelial Cell in Deep Venous Thrombosis by Promoting Caspase-1 Frontiers in cell and developmental biology [PMID: 35445025] (WB, Human)
• Gritsenko A, DIaz-Pino R, LOpez-CastejOn G NLRP3 inflammasome triggers interleukin-37 release from human monocytes European journal of immunology 2022-04-16 [PMID: 35429346] (WB, Human)
• Rao SD, Chen Q, Wang Q et al. M24B aminopeptidase inhibitors selectively activate the CARD8 inflammasome Nature chemical biology 2022-02-14 [PMID: 35165443]
• Wang S, Luke CJ, Pak SC et al. SERPINB3 (SCCA1) inhibits cathepsin L and lysoptosis, protecting cervical cancer cells from chemoradiation Communications Biology 2022-01-12 [PMID: 35022555] (Western Blot)
• Luke CJ, Markovina S, Good M et al. Lysoptosis is an evolutionarily conserved cell death pathway moderated by intracellular serpins Communications biology 2022-01-12 [PMID: 35022507] (Western Blot)
• Lu P, Wang J, Chiu L et al. Spleen tyrosine kinase regulates keratinocyte inflammasome activation and skin inflammation induced by UVB irradiation Free Radical Biology and Medicine 2022-01-01 [PMID: 35007704]
• Lee TA, Huang YT, Hsiao PF et al. Critical roles of irradiance in the regulation of UVB-induced inflammasome activation and skin inflammation in human skin keratinocytes Journal of photochemistry and photobiology. B, Biology 2022-01-01 [PMID: 34959183] (WB, Human)
• Zhao G, Li T, Liu X et al. African swine fever virus cysteine protease pS273R inhibits pyroptosis by noncanonically cleaving gasdermin D The Journal of biological chemistry 2021-12-08 [PMID: 34890644] (Porcine)
• Pastar I, Sawaya AP, Marjanovic J Et al. Intracellular Staphylococcus aureus triggers pyroptosis and contributes to inhibition of healing due to Perforin-2 suppression The Journal of clinical investigation 2021-11-02 [PMID: 34730110] (WB, Mouse, Human)
• Wen S, Deng F, Li L et al. VX-765 ameliorates renal injury and fibrosis in diabetes by regulating caspase-1-mediated pyroptosis and inflammation Journal of diabetes investigation 2021-09-08 [PMID: 34494385] (WB, IHC-P, Mouse, Human)
• Li Y, Wen C, Zhong J Et al. Enterococcus faecalis OG1RF induces apoptosis in MG63 cells via caspase-3/-8/-9 without activation of caspase-1/GSDMD Oral diseases 2021-08-09 [PMID: 34370363]
• Dhingra A, Sharp RC, Kim T et al. Assessment of a Small Molecule Synthetic Lignan in Enhancing Oxidative Balance and Decreasing Lipid Accumulation in Human Retinal Pigment Epithelia International Journal of Molecular Sciences 2021-05-28 [PMID: 34071220] (Western Blot)
• Sharif H, Hollingsworth LR, Griswold AR et al. Dipeptidyl peptidase 9 sets a threshold for CARD8 inflammasome formation by sequestering its active C-terminal fragment Immunity 2021-05-13 [PMID: 34019797]
• Huairui Shi, Yang Gao, Zhen Dong, Ji’e Yang, Rifeng Gao, Xiao Li, Shuqi Zhang, Leilei Ma, Xiaolei Sun, Zeng Wang, Feng Zhang, Kai Hu, Aijun Sun, Junbo Ge GSDMD-Mediated Cardiomyocyte Pyroptosis Promotes Myocardial I/R Injury Circulation Research 2021-06-15 [PMID: 34015941]
• Orzalli MH, Prochera A, Payne L et al. Virus-mediated inactivation of anti-apoptotic Bcl-2 family members promotes Gasdermin-E-dependent pyroptosis in barrier epithelial cells Immunity 2021-05-05 [PMID: 33979579]
• Gomez A, Serrano A, Salero E et al. Tumor necrosis factor-alpha and interferon-gamma induce inflammasome-mediated corneal endothelial cell death Experimental eye research 2021-04-17 [PMID: 33848524]
• Hollingsworth LR, Sharif H, Griswold AR et al. DPP9 sequesters the C terminus of NLRP1 to repress inflammasome activation Nature 2021-03-17 [PMID: 33731932]
• Xu W, Cao L, Hao H Apaf-1 Pyroptosome Senses Mitochondrial Permeability Transition Cell Metab 2020-12-14 [PMID: 33308446]
• Boal-Carvalho I, Mazel-Sanchez B, Silva F et al. Influenza A viruses limit NLRP3-NEK7-complex formation and pyroptosis in human macrophages EMBO Rep 2020-11-12 [PMID: 33180976] (WB)
• Lichtenegger S, Stiehler J, Saiger S et al. Burkholderia pseudomallei triggers canonical inflammasome activation in a human primary macrophage-based infection model Aging (Albany NY) 2020-10-24 [PMID: 33137811] (ICC/IF, IP, Human)
• Gritsenko, A, Yu, S Et al. Priming Is Dispensable for NLRP3 Inflammasome Activation in Human Monocytes In Vitro. Front Immunol 2020-10-27 [PMID: 33101286] (IP, Chemotaxis, WB, Human)
• Kwon T, Lee C, Park M et al. Oxidative photocatalysis on membranes triggers non-canonical pyroptosis Research Square 2023-07-13 (WB)
• Beckwith KS, Beckwith MS, Ullmann S et al. Plasma membrane damage causes NLRP3 activation and pyroptosis during Mycobacterium tuberculosis infection Nat Commun 2020-05-10 [PMID: 32385301]
• Wang Q, Shan L The CARD8 inflammasome drives CD4+T-cell depletion in HIV-1 infection bioRxiv 2023-03-20
• Chui AJ, Griswold AR, Taabazuing CY et al. Activation of the CARD8 Inflammasome Requires a Disordered Region Cell Rep 2020-10-13 [PMID: 33053349] (WB, IP, Human)
• Linder A, Bauernfried S, Cheng Y et al. CARD8 inflammasome activation triggers pyroptosis in human T cells EMBO J. 2020-08-25 [PMID: 32840892] (WB, Human)
• Johnson DC, Okondo MC, Orth EL et al. DPP8/9 inhibitors activate the CARD8 inflammasome in resting lymphocytes Cell Death Dis 2020-08-14 [PMID: 32796818] (KO, WB, Mouse, Rat, Human)
• Fei L, Jingyuan X, Fangte L et al. Preconditioning with rHMGB1 ameliorates lung ischemia-reperfusion injury by inhibiting alveolar macrophage pyroptosis via the Keap1/Nrf2/HO-1 signaling pathway J Transl Med 2020-08-05 [PMID: 32758258] (ICC/IF, Mouse)
• Chen H, Gan X, Li Y et al. NLRP12- and NLRC4-mediated corneal epithelial pyroptosis is driven by GSDMD cleavage accompanied by IL-33 processing in dry eye Ocul Surf 2020-07-28 [PMID: 32735949] (WB, ICC/IF, Mouse)
• Sharif H, Hollingsworth L, Griswold A, et al. Structural mechanism of CARD8 regulation by DPP9 bioRxiv 2021-01-15 [PMID: 32558991]
• Yang F, Zhu W, Cai X et al. Minocycline alleviates NLRP3 inflammasome-dependent pyroptosis in monosodium glutamate-induced depressive rats Biochem. Biophys. Res. Commun. 2020-04-01 [PMID: 32245616] (WB, Rat)
• Wen S, Wang ZH, Zhang CX et al. Caspase-3 Promotes Diabetic Kidney Disease Through Gasdermin E-Mediated Progression to Secondary Necrosis During Apoptosis Diabetes Metab Syndr Obes 2020-02-10 [PMID: 32104028] (WB, Human, Mouse)
• Ball DP, Taabazuing CY, Griswold AR et al. Caspase-1 interdomain linker cleavage is required for pyroptosis Life Sci Alliance 2020-03-01 [PMID: 32051255] (WB, Human)
• Ma J, Ramachandran M, Jin C et al. Characterization of virus-mediated immunogenic cancer cell death and the consequences for oncolytic virus-based immunotherapy of cancer Cell Death Dis 2020-01-22 [PMID: 31969562] (WB, Human)
• Grossi S, Fenini G, Kockmann T, et al. Inactivation of the cytoprotective major vault protein by caspase-1 and -9 in epithelial cells during apoptosis: caspase-1 and -9 inactivate the major vault protein J. Invest. Dermatol. 2019-12-23 [PMID: 31877317]
• Pandori WJ, Lima TS, Mallya S et al. Toxoplasma gondii activates a Syk-CARD9-NF-kappaB signaling axis and gasdermin D-independent release of IL-1beta during infection of primary human monocytes PLoS Pathog. 2019-08-01 [PMID: 31449558] (KO, WB, Human)
• Burgener SS, Leborgne NGF, Snipas SJ et al. Cathepsin G Inhibition by Serpinb1 and Serpinb6 Prevents Programmed Necrosis in Neutrophils and Monocytes and Reduces GSDMD-Driven Inflammation. Cell Rep. 2019-06-18 [PMID: 31216481] (WB, KD, KD, WB, Mouse)
  
  Details:
  Citation used the Azide and BSA Free format of this antibody.
• Bachovchin D, Chui A, Okondo M et al. N-terminal degradation activates the Nlrp1b inflammasome Science 2019-03-16 [PMID: 30872531]
• Kerr NA, de Rivero Vaccari JP, Umland O et al. Human Lung Cell Pyroptosis Following Traumatic Brain Injury. Cells 2019-01-18 [PMID: 30669285] (WB, Human)
• Mejias NH, Martinez CC, Stephens ME, de Rivero Vaccari JP. Contribution of the inflammasome to inflammaging. J Inflamm (Lond). 2018-11-16 [PMID: 30473634] (Mouse)
• Semino C, Carta S, Gattorno M et al. Progressive waves of IL-1B release by primary human monocytes via sequential activation of vesicular and gasdermin D-mediated secretory pathways Cell Death Dis 2018-10-23 [PMID: 30352992] (WB)
• Zhang Z, Shao X, Jiang N et al. Caspase-11-mediated tubular epithelial pyroptosis underlies contrast-induced acute kidney injury. Cell Death Dis 2018-09-24 [PMID: 30250284] (ICC/IF, Human)
• Kulkarni HS, Elvington ML, Perng YC et al. Intracellular C3 Protects Human Airway Epithelial Cells from Stress-Associated Cell Death. Am. J. Respir. Cell Mol. Biol. 2018-08-29 [PMID: 30156437] (WB, Human)
• Johnson DC, Taabazuing CY, Okondo MC et al. DPP8/DPP9 inhibitor-induced pyroptosis for treatment of acute myeloid leukemia. Nat. Med. 2018-07-02 [PMID: 29967349] (WB, Human)
• Evavold CL, Ruan J, Tan Y et al. The Pore-Forming Protein Gasdermin D Regulates Interleukin-1 Secretion from Living Macrophages. Immunity [PMID: 29195811] (WB, Human)
• Evavold CL, Ruan J, Tan Y et al. The Pore-Forming Protein Gasdermin D Regulates Interleukin-1 Secretion from Living Macrophages. Immunity 2017-11-28 [PMID: 29195211] (WB, Human)
• Taabazuing CY, Okondo MC, Bachovchin DA. Pyroptosis and Apoptosis Pathways Engage in Bidirectional Crosstalk in Monocytes and Macrophages. Cell Chem Biol 2017-04-06 [PMID: 28392147]
• Okondo MC, Johnson DC, Sridharan R et al. DPP8 and DPP9 inhibition induces pro-caspase-1-dependent monocyte and macrophage pyroptosis. Nat. Chem. Biol. 2016-11-07 [PMID: 27820798]
• Liu X, Zhang Z, Ruan J et al. Inflammasome-activated gasdermin D causes pyroptosis by forming membrane pores Nature 2016-07-07 [PMID: 27383986]
• Shi J, Zhao Y, Wang K et al. Cleavage of GSDMD by inflammatory caspases determines pyroptotic cell death. Nature 2015-09-16 [PMID: 26375003] (WB)

Review for Gasdermin D Antibody (NBP2-33422) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Eric Wang WB Human 06/21/2021

Summary

• Application: Western Blot
• Sample Tested: THP-1 cell lysate
• Species: Human
• Lot: Unavailable &#40;the product vial was discarded&#41;

Bioinformatics

• Gene Symbol: GSDMD
• Uniprot:
  • P57764(Human)