GARNL1 Antibody - BSA Free

Western Blot: GARNL1 Antibody [NBP2-82874] - Host: Rabbit. Target Name: RALGAPA1. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GARNL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GARNL1 Antibody - BSA Free (NBP2-82874) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GARNL1. Peptide sequence: MFSKKPHGDVKKSTQKVLDTKKDALTRLKHLRIVIENAESIDLKQFFDQH The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RALGAPA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GARNL1 Antibody - BSA Free

• DKFZp566D133
• DKFZp667F074
• GAP-related interacting protein to E12
• GARNL1p240
• GRIPEGAP-related-interacting partner to E12
• GTPase activating RANGAP domain-like 1
• GTPase activating Rap/RanGAP domain-like 1
• KIAA0884GTPase-activating Rap/Ran-GAP domain-like 1
• Ral GTPase activating protein, alpha subunit 1 (catalytic)
• ral GTPase-activating protein alpha subunit 1
• ral GTPase-activating protein subunit alpha-1
• RalGAPalpha1
• Tuberin-like protein 1
• TULIP1Tulip1

Background

Interacting partner of the transcription factor TCF3/isoform E12, mainly in the developing embryonicforebrain. May be an important transcriptional regulator of downstream target genes under the control of TCF3/E12, bydisrupting HLH dimer formation of TCF3/E12 with other proteins. May be involved in neuronal differentiation (Bysimilarity)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RALGAPA1