GARNL1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GARNL1. Peptide sequence: MFSKKPHGDVKKSTQKVLDTKKDALTRLKHLRIVIENAESIDLKQFFDQH The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RALGAPA1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for GARNL1 Antibody - BSA Free
Background
Interacting partner of the transcription factor TCF3/isoform E12, mainly in the developing embryonicforebrain. May be an important transcriptional regulator of downstream target genes under the control of TCF3/E12, bydisrupting HLH dimer formation of TCF3/E12 with other proteins. May be involved in neuronal differentiation (Bysimilarity)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Mu, Rt
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC-P, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Publications for GARNL1 Antibody (NBP2-82874) (0)
There are no publications for GARNL1 Antibody (NBP2-82874).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GARNL1 Antibody (NBP2-82874) (0)
There are no reviews for GARNL1 Antibody (NBP2-82874).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GARNL1 Antibody (NBP2-82874) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GARNL1 Products
Blogs on GARNL1