GAMT Antibody

Images

 
Western Blot: GAMT Antibody [NBP2-14036] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GAMT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMK SKYSDITIMFEETQVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAMT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GAMT Protein (NBP2-14036PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GAMT Antibody

  • EC 2.1.1.2
  • guanidinoacetate N-methyltransferase
  • PIG2
  • TP53I2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00984
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-60082
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69295
Species: Hu
Applications: WB, ICC/IF, IHC
AF2009
Species: Hu
Applications: WB, IHC
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
AF6526
Species: Hu
Applications: WB
NBP1-59580
Species: Hu, Rt
Applications: WB
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-87098
Species: Hu
Applications: IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14036
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GAMT Antibody (NBP2-14036) (0)

There are no publications for GAMT Antibody (NBP2-14036).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAMT Antibody (NBP2-14036) (0)

There are no reviews for GAMT Antibody (NBP2-14036). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GAMT Antibody (NBP2-14036) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAMT Products

Bioinformatics Tool for GAMT Antibody (NBP2-14036)

Discover related pathways, diseases and genes to GAMT Antibody (NBP2-14036). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAMT Antibody (NBP2-14036)

Discover more about diseases related to GAMT Antibody (NBP2-14036).
 

Pathways for GAMT Antibody (NBP2-14036)

View related products by pathway.

PTMs for GAMT Antibody (NBP2-14036)

Learn more about PTMs related to GAMT Antibody (NBP2-14036).

Blogs on GAMT

There are no specific blogs for GAMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAMT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAMT