GAMT Antibody - BSA Free

Western Blot: GAMT Antibody [NBP2-14036] - Analysis in human cell line HepG2.

Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036] - Staining of human rectum shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036] - Staining of human liver shows weak to moderate cytoplasmic postivity in hepatocytes na moderate staining of bile canaliculi.

Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036] - Staining of human placenta shows strong cytoplasmic postivity in trophoblastic cells.

Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036] - Staining of human pancreas shows moderate to strong cytoplasmic postivity in exocrine glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GAMT Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: DGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVP
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GAMT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GAMT Protein (NBP2-14036PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GAMT Antibody - BSA Free

• EC 2.1.1.2
• guanidinoacetate N-methyltransferase
• PIG2
• TP53I2

Background

GAMT is encoded by this gene is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in this gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals. Two transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GAMT