gamma-2 Tubulin Antibody

Images

 
Western Blot: gamma-2 Tubulin Antibody [NBP1-57013] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

gamma-2 Tubulin Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to TUBG2 (tubulin, gamma 2) The peptide sequence was selected from the middle region of TUBG2. Peptide sequence FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TUBG2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for gamma-2 Tubulin Antibody

  • gamma-2 Tubulin
  • Gamma-2-tubulin
  • MGC131994
  • TUBG2
  • tubulin gamma-2 chain
  • tubulin, gamma 2

Background

Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome, suggesting that it is involved in the minus-end nucleation of microtubule assembly.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for gamma-2 Tubulin Antibody (NBP1-57013) (0)

There are no publications for gamma-2 Tubulin Antibody (NBP1-57013).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for gamma-2 Tubulin Antibody (NBP1-57013) (0)

There are no reviews for gamma-2 Tubulin Antibody (NBP1-57013). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for gamma-2 Tubulin Antibody (NBP1-57013) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional gamma-2 Tubulin Products

Research Areas for gamma-2 Tubulin Antibody (NBP1-57013)

Find related products by research area.

Blogs on gamma-2 Tubulin

There are no specific blogs for gamma-2 Tubulin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our gamma-2 Tubulin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBG2
Uniprot