GALNT13 Antibody


Western Blot: GALNT13 Antibody [NBP1-69624] - This Anti-GALNT13 antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

GALNT13 Antibody Summary

Synthetic peptides corresponding to GALNT13 The peptide sequence was selected from the N terminal of GALNT13 (NP_443149). Peptide sequence CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GALNT13 Antibody

  • Acetylgalactosaminyltransferase 13
  • EC
  • FLJ16031
  • FLJ41157
  • GalNAc transferase 13
  • GalNAc-T13
  • GalNAc-T13MGC119459
  • GALNT13
  • KIAA1918H_NH0187G20.1
  • MGC119461
  • Polypeptide GalNAc transferase 13
  • polypeptide N-acetylgalactosaminyltransferase 13
  • Pp-GaNTase 13
  • Protein-UDP acetylgalactosaminyltransferase 13
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 13 (GalNAc-T13)
  • WUGSC:H_NH0187G20.1


The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT; EC family, which initiate O-linked glycosylation of mucins by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT; EC family, which initiate O-linked glycosylation of mucins (see MUC3A, MIM 158371) by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for GALNT13 Antibody (NBP1-69624) (0)

There are no publications for GALNT13 Antibody (NBP1-69624).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALNT13 Antibody (NBP1-69624) (0)

There are no reviews for GALNT13 Antibody (NBP1-69624). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GALNT13 Antibody (NBP1-69624) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GALNT13 Products

Bioinformatics Tool for GALNT13 Antibody (NBP1-69624)

Discover related pathways, diseases and genes to GALNT13 Antibody (NBP1-69624). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GALNT13 Antibody (NBP1-69624)

Discover more about diseases related to GALNT13 Antibody (NBP1-69624).

Pathways for GALNT13 Antibody (NBP1-69624)

View related products by pathway.

PTMs for GALNT13 Antibody (NBP1-69624)

Learn more about PTMs related to GALNT13 Antibody (NBP1-69624).

Blogs on GALNT13

There are no specific blogs for GALNT13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GALNT13 Antibody and receive a gift card or discount.


Gene Symbol GALNT13