GALNT13 Antibody - BSA Free

Western Blot: GALNT13 Antibody [NBP1-69624] - This Anti-GALNT13 antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.

Product Discontinued

GALNT13 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GALNT13 The peptide sequence was selected from the N terminal of GALNT13 (NP_443149). Peptide sequence CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GALNT13
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 64 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GALNT13 Antibody - BSA Free

• Acetylgalactosaminyltransferase 13
• EC 2.4.1.41
• FLJ16031
• FLJ41157
• GalNAc transferase 13
• GalNAc-T13
• GalNAc-T13MGC119459
• GALNT13
• KIAA1918H_NH0187G20.1
• MGC119461
• Polypeptide GalNAc transferase 13
• polypeptide N-acetylgalactosaminyltransferase 13
• Pp-GaNTase 13
• Protein-UDP acetylgalactosaminyltransferase 13
• UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13
• UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 13 (GalNAc-T13)
• WUGSC:H_NH0187G20.1

Background

The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT; EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT; EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins (see MUC3A, MIM 158371) by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GALNT13
• Entrez:
  • 114805(Human)
• Uniprot:
  • Q8IUC8()