Galectin 13 Antibody

Western Blot: Galectin 13 Antibody [NBP1-80504] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Product Discontinued

Galectin 13 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human LGALS13. Peptide sequence AFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LGALS13
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Galectin 13 Antibody

• beta-galactoside-binding lectin
• EC 3.1.1.5
• GAL13
• gal-13
• galectin-13
• lectin, galactoside-binding, soluble, 13
• PLAC8galectin 13
• Placental protein 13
• Placental tissue protein 13
• PP13galactoside-binding soluble lectin 13

Background

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene has lysophospholipase activity. It is composed of two identical subunits which are held together by disulfide bonds. This protein has structural similarity to several members of the beta-galactoside-binding S-type lectin family. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LGALS13
• Uniprot:
  • NP_037400(Human)