GABA Receptor Epsilon Antibody - BSA Free

Western Blot: GABA Receptor Epsilon Antibody [NBP1-80081] - Host: Rabbit. Target Name: GABRE. Sample Tissue: Human 786-0 Whole Cell. Antibody Dilution: 3ug/ml

Western Blot: GABA Receptor Epsilon Antibody [NBP1-80081] - Human Placenta lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GABA Receptor Epsilon Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human GABRE. Peptide sequence KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GABRE
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GABA Receptor Epsilon Antibody - BSA Free

• GABA A R epsilon
• GABA(A) receptor subunit epsilon
• GABAAR epsilon
• GABAARe
• gamma-aminobutyric acid (GABA) A receptor, epsilon
• gamma-aminobutyric acid receptor subunit epsilon

Background

The product of the GABA Receptor Epsilon gene belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyricacid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptictransmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in acluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively splicedtranscript variants have been identified, but only one is thought to encode a protein. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GABRE