GABA Receptor Epsilon Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptide directed towards the N terminal of human GABRE. Peptide sequence DVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDH. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GABRE |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for GABA Receptor Epsilon Antibody - BSA Free
Background
The product of the GABA Receptor Epsilon gene belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyricacid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptictransmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in acluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively splicedtranscript variants have been identified, but only one is thought to encode a protein. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Po
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Publications for GABA Receptor Epsilon Antibody (NBP1-80068) (0)
There are no publications for GABA Receptor Epsilon Antibody (NBP1-80068).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GABA Receptor Epsilon Antibody (NBP1-80068) (0)
There are no reviews for GABA Receptor Epsilon Antibody (NBP1-80068).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GABA Receptor Epsilon Antibody (NBP1-80068) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GABA Receptor Epsilon Products
Research Areas for GABA Receptor Epsilon Antibody (NBP1-80068)
Find related products by research area.
|
Blogs on GABA Receptor Epsilon