GABA-B R2 Recombinant Protein Antigen

Images

 
There are currently no images for GABA-B R2 Protein (NBP1-89803PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GABA-B R2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GABBR2.

Source: E. coli

Amino Acid Sequence: SKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNLGNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GABBR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89803.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GABA-B R2 Recombinant Protein Antigen

  • G protein-coupled receptor 51
  • GABA B R2
  • GABABR2
  • GABA-BR2
  • GABA-B-R2
  • GABABR2GABA-B receptor 2
  • GABBR2
  • gamma-aminobutyric acid (GABA) B receptor, 2
  • gamma-aminobutyric acid type B receptor subunit 2
  • gb2
  • GPR51
  • GPR51GABA-B receptor, R2 subunit
  • GPRC3B
  • GPRC3BFLJ36928
  • G-protein coupled receptor 51
  • HG20HRIHFB2099

Background

Gamma-aminobutyric acid (GABA) is the primary inhibitory neurotransmitter in the central nervous system. There are two major classes of GABA receptors the GABAA and the GABAB subtype of receptors. GABAB receptors are heterodimeric G protein-coupled receptors that mediate slow synaptic inhibition in the central nervous system. Moss and colleagues (Couve, et al., 2002) recently demonstrated that the functional coupling of GABAB R1/GABAB R2 receptors to inwardly rectifying K+ channels rapidly desensitizes. This effect is alleviated after direct phosphorylation of a single serine residue (Ser892) in the cytoplasmic tail of GABAB R2 by cyclic AMP (cAMP)-dependent protein kinase (PKA). In addition to it postsynaptic effects GABAB receptors localized to the presynaptic region have been reported to restrict the availability of synaptic vesicles for release (Sakaba and Neher, 2003).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002550-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, KD, WB
NBP3-16797
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-31661
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46198
Species: Hu
Applications: IHC, IHC-P, WB
MAB7446
Species: Hu
Applications: CyTOF-ready, Flow
NBP3-25643
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB

Publications for GABA-B R2 Protein (NBP1-89803PEP) (0)

There are no publications for GABA-B R2 Protein (NBP1-89803PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABA-B R2 Protein (NBP1-89803PEP) (0)

There are no reviews for GABA-B R2 Protein (NBP1-89803PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GABA-B R2 Protein (NBP1-89803PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GABA-B R2 Products

Research Areas for GABA-B R2 Protein (NBP1-89803PEP)

Find related products by research area.

Blogs on GABA-B R2

There are no specific blogs for GABA-B R2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GABA-B R2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GABBR2