GABA-B R2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

GABA-B R2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GABBR2.
  
  

  Source: E. coli

  Amino Acid Sequence: SKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNLGNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPI

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GABBR2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89803.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GABA-B R2 Recombinant Protein Antigen

• G protein-coupled receptor 51
• GABA B R2
• GABABR2
• GABA-BR2
• GABA-B-R2
• GABABR2GABA-B receptor 2
• GABBR2
• gamma-aminobutyric acid (GABA) B receptor, 2
• gamma-aminobutyric acid type B receptor subunit 2
• gb2
• GPR51
• GPR51GABA-B receptor, R2 subunit
• GPRC3B
• GPRC3BFLJ36928
• G-protein coupled receptor 51
• HG20HRIHFB2099

Background

Gamma-aminobutyric acid (GABA) is the primary inhibitory neurotransmitter in the central nervous system. There are two major classes of GABA receptors the GABAA and the GABAB subtype of receptors. GABAB receptors are heterodimeric G protein-coupled receptors that mediate slow synaptic inhibition in the central nervous system. Moss and colleagues (Couve, et al., 2002) recently demonstrated that the functional coupling of GABAB R1/GABAB R2 receptors to inwardly rectifying K+ channels rapidly desensitizes. This effect is alleviated after direct phosphorylation of a single serine residue (Ser892) in the cytoplasmic tail of GABAB R2 by cyclic AMP (cAMP)-dependent protein kinase (PKA). In addition to it postsynaptic effects GABAB receptors localized to the presynaptic region have been reported to restrict the availability of synaptic vesicles for release (Sakaba and Neher, 2003).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GABBR2