Home » G-substrate » G-substrate Antibodies » G-substrate Antibody

G-substrate Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: G-substrate Antibody [H00010842-D01P] - Analysis of C7orf16 expression in transfected 293T cell line by C7orf16 polyclonal antibody.Lane 1: C7orf16 transfected lysate(17.90 KDa).Lane 2: Non-transfected lysate.
Western Blot: G-substrate Antibody [H00010842-D01P] - Analysis of C7orf16 expression in transfected 293T cell line by C7orf16 polyclonal antibody.Lane 1: C7orf16 transfected lysate(17.90 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

G-substrate Antibody Summary

Immunogen
C7orf16 (NP_006649.1, 1 a.a. - 155 a.a.) full-length human protein. MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAI
Specificity
Reacts with chromosome 7 open reading frame 16.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP1R17
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for G-substrate Antibody

  • chromosome 7 open reading frame 16
  • GSBSG-substrate

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DARPP-32 [p Thr75]
Antibody
NB300-234
Western Blot: DARPP32 [p Thr75] Antibody [NB300-234] - Analysis of rat caudate lysate showing specific immunolabeling of the ~32k DARPP-32 phosphorylated at Thr75 (Control). The phosphospecificity of this labeling is shown in the second lane (lambda-phosphatase). The blot is identical to the control except that it was incubated (1200 units for 30 min) before being exposed to the Anti-Thr75 DARPP-32. The immunolabeling is completely eliminated by treatment.
Western Blot: DARPP32 [p Thr75] Antibody [NB300-234] - Analysis of Rat caudate lysates prepared from caudate slices that had been incubated in the absence and presence of okadaic acid. The labeling by the antibody to DARPP-32 Thr75 is markedly increased by the okadaic acid treatment.
(9 Publications)
Species: Hu, Mu, Rt
Applications: WB
Protein
Phosphatase inhibitor ...
NBP2-67695
Western Blot: Protein Phosphatase inhibitor 1 Antibody (SN0756) [NBP2-67695] - Analysis of PPP1R1A on Rat brain lysates using anti-PPP1R1A antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Protein Phosphatase inhibitor 1 Antibody (SN0756) [NBP2-67695] - Staining PPP1R1A in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Protein Phosphatase inhibitor 1 Antibody (SN0756) [NBP2-67695] - Analysis of paraffin-embedded mouse kidney tissue using anti-PPP1R1A antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
cGK1/PRKG1 Antibody
NBP2-14843
Western Blot: cGK1/PRKG1 Antibody [NBP2-14843] - Lane 1: MW marker, Lane 2: HeLa cell lysate, Lane 3: Rat brain tissue extract, Lane 4: MDBK cell lysate.
(1 Review)
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P, IP
Synapsin I Antibody
NB300-104
Western Blot: Synapsin I Antibody [NB300-104] - 10 ug of rat brain lysate showing specific immunolabeling of the ~78 kDa Synapsin I doublet.
Immunocytochemistry/Immunofluorescence: Synapsin I Antibody [NB300-104] - ICC-IF validation analysis of Synapsin 1 Antibody on cultured rat caudate neurons. This representative image shows the punctate distribution of Synapsin 1 (green) and MAP (red) proteins in a neuronal cell.
Immunohistochemistry-Paraffin: Synapsin I Antibody [NB300-104] - Human cerebellum section, formalin fixed paraffin embedded. Stained with Synpasin-1 at 1:250. Citrate antigen retrieval at pH 6. Image from verified customer review.
(1 Review)
(41 Publications)
Species: Hu, Mu, Rt, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
CD55/DAF Antibody
NBP1-85466
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining in human lung and kidney tissues using anti-CD55 antibody. Corresponding CD55 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human lung shows high expression.
(2 Publications)
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
Annexin A2
Antibody [Unconjugate
AF3928
Western blot shows lysates of A431 human epithelial carcinoma cell line, NIH-3T3 mouse embryonic fibroblast cell line, and L6 rat myoblast cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat Annexin A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3928) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Annexin A2 at approximately 39 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2.
Annexin A2 was detected in immersion fixed paraffin-embedded sections of normal human liver using Goat Anti-Human/Mouse/Rat Annexin A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3928) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membranes of hepatocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of A431 human epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for Annexin A2 at approximately 45 kDa (as indicated) using 50 µg/mL of Goat Anti-Human/Mouse/Rat Annexin A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3928) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12‑230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
Endoglycan/PODXL2
Antibody
AF3534
Endoglycan/PODXL2 was detected in perfusion fixed frozen sections of mouse testis using 1.7 µg/mL Goat Anti-Mouse Endoglycan/PODXL2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3534) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counter­stained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(1 Publication)
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Transcobalamin II
Antibody
AF7895
Western blot shows lysates of HUVEC human umbilical vein endothelial cells and RPMI 8226 human multiple myeloma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat Transcobalamin II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7895) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Transcobalamin II at approximately 43 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Transcobalamin II was detected in immersion fixed paraffin-embedded sections of human kidney using Sheep Anti-Human/Mouse/Rat Transcobalamin II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7895) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm in epithelial cell convoluted tubules. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
Cathepsin G
Antibody
NBP2-33498
Immunohistochemistry-Paraffin: Cathepsin G Antibody [NBP2-33498] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: Cathepsin G Antibody [NBP2-33498] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: Cathepsin G Antibody [NBP2-33498] - Staining of human cerebral cortex shows low expression as expected.
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(37 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
PPP2R4 Antibody
(4D9)
NBP2-37530
Western Blot: PPP2R4 Antibody (4D9) [NBP2-37530] - Western blot analysis using PPP2R4 mAb against human PPP2R4 (AA: 1-154) recombinant protein. (Expected MW is 41 kDa)
Immunocytochemistry/Immunofluorescence: PPP2R4 Antibody (4D9) [NBP2-37530] - Immunofluorescence analysis of Hela cells using PPP2R4 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: PPP2R4 Antibody (4D9) [NBP2-37530] - Immunohistochemical analysis of paraffin-embedded cervical cancer tissues using PPP2R4 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
SUG1 Antibody
NBP1-87372
Western Blot: SUG1 Antibody [NBP1-87372] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: SUG1 Antibody [NBP1-87372] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: SUG1 Antibody [NBP1-87372] - Staining of human testis.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Western Blot: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Pancreatic Amylase(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Pancreatic Amylase.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded ovary using anti-Pancreatic Amylase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Adenocarcinoma of breast using anti-Pancreatic Amylase mouse monoclonal antibody.
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
Proteasome 19S S3
Antibody (OTI2A2) - A ...
NBP2-73636
Western Blot: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Proteasome 19S S3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Prot
Flow Cytometry: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostaining by anti-Proteasome 19S S3 antibody, and then analyzed by flow cytometry.
Western Blot: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - Analysis of extracts (35ug) from 9 different cell lines by using anti-Proteasome 19S S3 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, CyTOF-ready
VASP Antibody
(OTI4D6)
NBP2-00555
Western Blot: VASP Antibody (OTI4D6) [NBP2-00555] - Analysis of extracts (35ug) from 9 different cell lines by using anti-VASP monoclonal antibody.
Immunocytochemistry/Immunofluorescence: VASP Antibody (OTI4D6) [NBP2-00555] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY VASP.
Immunohistochemistry-Paraffin: VASP Antibody (OTI4D6) [NBP2-00555] - Staining of paraffin-embedded Human lymphoma tissue using anti-VASP mouse monoclonal antibody.
(1 Publication)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Standard curve using the internal RelA standard.
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Nuclear translocation of NF-kB p65 with LPS in Jurkat cells. Jurkat cells, grown to a density of 2X10(6) cells/ml, were treated with LPS (15 ug/ml). The cells were harvested at various indicated time points, and cell lysates were tested in Western analysis using NB100-56712 and also in this ELISA Kit.
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Immunofluorescence indicates NF-kB p65 subunit was expressed exclusively in AA-G groups and AST-G cytoplasm. High glucose stimulation impact on TSMCs in NF-kB pathway. (A) NF-kB p65 protein subunit expression in TSMCs in each group. (B) NF-kB p65 subunit immunofluorescence. Each number denotes different subunits. Alexa 488 green served as secondary antibodies.Citation: Hara K, Hamada C, Wakabayashi K, Kanda R, Kaneko K, Horikoshi S, et al. (2017) Scavenging of reactive oxygen species by astaxanthin inhibits epithelial-mesenchymal transition in high glucose-stimulated mesothelial cells. PLoS ONE 12(9): e0184332. https://doi.org/10.1371/journal.pone.0184332
(85 Publications)
Species: Hu, Mu, Rt
NOLC1 Antibody
NBP1-58200
Western Blot: NOLC1 Antibody [NBP1-58200] - NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5ug/ml.
Immunocytochemistry/Immunofluorescence: NOLC1 Antibody [NBP1-58200] - Zebrafish kidney, 1:250 Image Submitted By: James Lister Virginia Commonwealth University
Immunohistochemistry-Paraffin: NOLC1 Antibody [NBP1-58200] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
G-substrate
Antibody
H00010842-D01P
G-substrate Antibody
Species: Hu
Applications: WB

Publications for G-substrate Antibody (H00010842-D01P) (0)

There are no publications for G-substrate Antibody (H00010842-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G-substrate Antibody (H00010842-D01P) (0)

There are no reviews for G-substrate Antibody (H00010842-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G-substrate Antibody (H00010842-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional G-substrate Products

Bioinformatics Tool for G-substrate Antibody (H00010842-D01P)

Discover related pathways, diseases and genes to G-substrate Antibody (H00010842-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for G-substrate Antibody (H00010842-D01P)

Find related products by research area.

Blogs on G-substrate

There are no specific blogs for G-substrate, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our G-substrate Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PPP1R17
Entrez
Uniprot