G-substrate Antibody (3E6) - Azide and BSA Free

Sandwich ELISA: G-substrate Antibody (3E6) [H00010842-M01] - Detection limit for recombinant GST tagged C7orf16 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3E6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

G-substrate Antibody (3E6) - Azide and BSA Free Summary

• Immunogen: C7orf16 (NP_006649, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MMSTEQMQPLELSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGK
• Specificity: C7orf16 - chromosome 7 open reading frame 16 (3E6)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PPP1R17
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for G-substrate Antibody (3E6) - Azide and BSA Free

• chromosome 7 open reading frame 16
• GSBSG-substrate

Background

G-substrate inhibits protein phosphatase-2A and protein phosphatase-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP1R17
• Entrez:
  • 10842(Human)
• Uniprot:
  • NP_006649(Human)