Recombinant Human G protein beta 4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human G protein beta 4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-340 of Human GNB4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSELEQLRQEAEQLRNQIQDAREACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDDSQIVTSSGDTTCALWDIETAQQTTTFTGHSGDVMSLSLSPDMRTFVSGACDASSKLWDIRDGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
GNB4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
63.14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human G protein beta 4 Protein

  • G protein beta-4 subunit
  • guanine nucleotide binding protein (G protein), beta polypeptide 4
  • guanine nucleotide binding protein beta subunit 4
  • guanine nucleotide-binding protein subunit beta-4
  • Transducin beta chain 4

Background

GNB4( AAH00873, 1 a.a. - 341 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP1-31116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88502
Species: Hu
Applications: IHC, IHC-P
NBP1-54155
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-84869
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF972
Species: Hu
Applications: WB, Simple Western, IHC
AF755
Species: Mu
Applications: WB, Block
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-40561
Species: Hu
Applications: WB, IP
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB

Publications for G protein beta 4 Recombinant Protein (H00059345-P01) (0)

There are no publications for G protein beta 4 Recombinant Protein (H00059345-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G protein beta 4 Recombinant Protein (H00059345-P01) (0)

There are no reviews for G protein beta 4 Recombinant Protein (H00059345-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G protein beta 4 Recombinant Protein (H00059345-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional G protein beta 4 Products

Bioinformatics Tool for G protein beta 4 Recombinant Protein (H00059345-P01)

Discover related pathways, diseases and genes to G protein beta 4 Recombinant Protein (H00059345-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G protein beta 4 Recombinant Protein (H00059345-P01)

Discover more about diseases related to G protein beta 4 Recombinant Protein (H00059345-P01).

Research Areas for G protein beta 4 Recombinant Protein (H00059345-P01)

Find related products by research area.

Blogs on G protein beta 4

There are no specific blogs for G protein beta 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human G protein beta 4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GNB4