G gamma14 Antibody (1G11-C7)

Images

 
Sandwich ELISA: G gamma14 Antibody (1G11-C7) [H00002793-M01] - Detection limit for recombinant GST tagged GNGT2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1G11-C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

G gamma14 Antibody (1G11-C7) Summary

Immunogen
GNGT2 (AAH08663, 1 a.a. ~ 69 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
Specificity
GNGT2 - guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GNGT2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for G gamma14 Antibody (1G11-C7)

  • G protein cone gamma 8 subunit
  • gamma-T2 subunit
  • G-GAMMA-8
  • G-gamma-9
  • G-GAMMA-C
  • GNG8
  • GNG9G gamma-C
  • GNGT8
  • guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 2
  • guanine nucleotide binding protein gamma 9
  • Guanine nucleotide binding protein gamma transducing activity polypeptide 2
  • guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2

Background

Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. There is evidence for use of multiple polyadenylation sites by this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-04725
Species: Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-52107
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
H00000314-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76626
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IF, IHC, IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
H00005164-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB367
Species: Ca, Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP1-37003
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-55158
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P
NBP2-55240
Species: Hu
Applications: IHC, IHC-P
AF3470
Species: Hu
Applications: ICC, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-81275
Species: Hu
Applications: IHC, IHC-P
H00002791-M01
Species: Hu
Applications: ELISA, PLA, S-ELISA, WB
NBP3-09392
Species: Hu, Mu
Applications: WB

Publications for G gamma14 Antibody (H00002793-M01) (0)

There are no publications for G gamma14 Antibody (H00002793-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G gamma14 Antibody (H00002793-M01) (0)

There are no reviews for G gamma14 Antibody (H00002793-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G gamma14 Antibody (H00002793-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional G gamma14 Products

Bioinformatics Tool for G gamma14 Antibody (H00002793-M01)

Discover related pathways, diseases and genes to G gamma14 Antibody (H00002793-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G gamma14 Antibody (H00002793-M01)

Discover more about diseases related to G gamma14 Antibody (H00002793-M01).
 

Pathways for G gamma14 Antibody (H00002793-M01)

View related products by pathway.

Research Areas for G gamma14 Antibody (H00002793-M01)

Find related products by research area.

Blogs on G gamma14

There are no specific blogs for G gamma14, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our G gamma14 Antibody (1G11-C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol GNGT2
Entrez
OMIM
Uniprot