G gamma14 Antibody (1G11-C7) - Azide and BSA Free

Sandwich ELISA: G gamma14 Antibody (1G11-C7) [H00002793-M01] - Detection limit for recombinant GST tagged GNGT2 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1G11-C7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

G gamma14 Antibody (1G11-C7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GNGT2 (AAH08663, 1 a.a. ~ 69 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
• Specificity: GNGT2 - guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GNGT2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for G gamma14 Antibody (1G11-C7) - Azide and BSA Free

• G protein cone gamma 8 subunit
• gamma-T2 subunit
• G-GAMMA-8
• G-gamma-9
• G-GAMMA-C
• GNG8
• GNG9G gamma-C
• GNGT8
• guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 2
• guanine nucleotide binding protein gamma 9
• Guanine nucleotide binding protein gamma transducing activity polypeptide 2
• guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2

Background

Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. There is evidence for use of multiple polyadenylation sites by this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNGT2
• Entrez:
  • 2793(Human)
• OMIM:
  • 603655(Human)
• Uniprot:
  • AAH08663(Human)