FZR1/CDH1 Antibody [HRP]

Name: FZR1/CDH1 Antibody [HRP]
Brand: Novus Biologicals
SKU: NBP3-38164H
Price: 609 USD
Availability: InStock

Submit a Review

Images

There are currently no images for FZR1/CDH1 Antibody (NBP3-38164H).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	Hu, Mu, RtSpecies Glossary
Applications	WB, ELISA, ICC/IF
Clonality	Polyclonal
Host	Rabbit
Conjugate	HRP

Order Details

View Available Conjugates

Catalog# & Conjugate	Size	Price
Alexa Fluor 350 NBP3-38164AF350

Alexa Fluor 405 NBP3-38164AF405

Alexa Fluor 488 NBP3-38164AF488

Alexa Fluor 532 NBP3-38164AF532

Alexa Fluor 594 NBP3-38164AF594

Alexa Fluor 647 NBP3-38164AF647

Alexa Fluor 700 NBP3-38164AF700

Alexa Fluor 750 NBP3-38164AF750

Allophycocyanin NBP3-38164APC

Biotin NBP3-38164B

CoraFluor 1 NBP3-38164CL1

DyLight 350 NBP3-38164UV

DyLight 405 NBP3-38164V

DyLight 488 NBP3-38164G

DyLight 550 NBP3-38164R

DyLight 594 NBP3-38164DL594

DyLight 650 NBP3-38164C

DyLight 680 NBP3-38164FR

DyLight 755 NBP3-38164IR

FITC NBP3-38164F

Janelia Fluor 525 NBP3-38164JF525

Janelia Fluor 549 NBP3-38164JF549

Janelia Fluor 646 NBP3-38164JF646

Janelia Fluor 669 NBP3-38164JF669

PE NBP3-38164PE

PerCP NBP3-38164PCP

Unconjugated NBP3-38164-100ul

mFluor Violet 450 SE NBP3-38164MFV450

mFluor Violet 500 SE NBP3-38164MFV500

mFluor Violet 610 SE NBP3-38164MFV610

View Available Formulations

Catalog# & Formulation	Size	Price
Standard Formulation NBP3-38164-100ul

BSA Free NBP3-38164-100ul

BSA Free NBP3-38164-20ul

Novus Biologicals offers 100% Guarantee

Conjugate	Catalog #	Availability	Size	Price
Alexa Fluor 350	NBP3-38164AF350
Alexa Fluor 405	NBP3-38164AF405
Alexa Fluor 488	NBP3-38164AF488
Alexa Fluor 532	NBP3-38164AF532
Alexa Fluor 594	NBP3-38164AF594
Alexa Fluor 647	NBP3-38164AF647
Alexa Fluor 700	NBP3-38164AF700
Alexa Fluor 750	NBP3-38164AF750
Allophycocyanin	NBP3-38164APC
Biotin	NBP3-38164B
CoraFluor 1	NBP3-38164CL1
DyLight 350	NBP3-38164UV
DyLight 405	NBP3-38164V
DyLight 488	NBP3-38164G
DyLight 550	NBP3-38164R
DyLight 594	NBP3-38164DL594
DyLight 650	NBP3-38164C
DyLight 680	NBP3-38164FR
DyLight 755	NBP3-38164IR
FITC	NBP3-38164F
Janelia Fluor 525	NBP3-38164JF525
Janelia Fluor 549	NBP3-38164JF549
Janelia Fluor 646	NBP3-38164JF646
Janelia Fluor 669	NBP3-38164JF669
PE	NBP3-38164PE
PerCP	NBP3-38164PCP
Unconjugated	NBP3-38164-100ul
mFluor Violet 450 SE	NBP3-38164MFV450
mFluor Violet 500 SE	NBP3-38164MFV500
mFluor Violet 610 SE	NBP3-38164MFV610

FZR1/CDH1 Antibody [HRP] Summary

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 224-493 of human FZR1/CDH1 (NP_057347.2). Sequence: DLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKESVSVLNLFTRIR
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	FZR1
Purity	Affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	ELISA Immunocytochemistry/ Immunofluorescence Western Blot
Application Notes	Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage	Store at 4C in the dark.
Buffer	PBS
Preservative	No Preservative
Purity	Affinity purified

Alternate Names for FZR1/CDH1 Antibody [HRP]

CDC20C
CDH1
Cdh1/Hct1 homolog
CDH1CDC20-like 1b
fizzy/cell division cycle 20 related 1 (Drosophila)
Fzr
FZR2
FZRCDC20-like protein 1
hCDH1
HCDHFYR
KIAA1242fizzy-related protein homolog

Background

FZR1( AAH13413, 1 a.a. - 494 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

APC Antibody - BSA
Free

NB100-91662

Immunohistochemistry-Paraffin APC Antibody - BSA Free

(2 Publications)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB

Coagulation Factor
XIV/Protein C Antibod ...

AF4885

(2 Publications)

Species: Mu

Applications: IP, WB

p19ARF/CDKN2A
Antibody - BSA Free

NB200-106

Western Blot p19ARF/CDKN2A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free

(1 Review)

(48 Publications)

Species: Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Cdc20 Antibody

NB100-59828

Immunohistochemistry-Paraffin Cdc20 Antibody

(7 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, IP, WB

RASSF1 Antibody
(OTI2B11)

NBP2-03644

Immunohistochemistry-Paraffin RASSF1 Antibody (OTI2B11)

(1 Publication)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(43 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Cyclin B1 Antibody
[Unconjugated]

AF6000

Western Blot Cyclin B1 Antibody [Unconjugated]

Simple Western Cyclin B1 Antibody [Unconjugated]

(12 Publications)

Species: Hu, Mu

Applications: IHC, Simple Western, WB

MLH1 Antibody
(SP08-04)

NBP2-67381

Immunocytochemistry/ Immunofluorescence MLH1 Antibody (SP08-04)

Immunohistochemistry-Paraffin MLH1 Antibody (SP08-04)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB

DAP Kinase 1
Antibody (SR1225) - B ...

NBP3-21649

Western Blot DAP Kinase 1 Antibody (SR1225) - BSA Free

Immunocytochemistry/ Immunofluorescence DAP Kinase 1 Antibody (SR1225) - BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, WB

MGMT Antibody (MT
23.2) - BSA Free

NB100-168

Flow Cytometry MGMT Antibody (MT 23.2) - BSA Free

(21 Publications)

Species: Hu, Mu(-)

Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB

Glutathione
S-Transferase pi 1/GS ...

NBP2-16756

Immunocytochemistry/ Immunofluorescence Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free

Immunohistochemistry-Paraffin Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free

(1 Review)

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

SUB1 Antibody -
BSA Free

NBP1-82454

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

p15INK4b/CDKN2B
Antibody (OTI3B6)

NBP2-45603

Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P, WB

beta-Catenin
Antibody [Unconjugate

AF1329

Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]

Simple Western beta-Catenin Antibody [Unconjugated]

(2 Reviews)

(34 Publications)

Species: Hu, Mu, Rt

Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB

PTTG1 Antibody

NBP2-20287

Immunocytochemistry/ Immunofluorescence PTTG1 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, IP, WB

MUL1 Antibody
(5H6.2D5) - BSA Free

NBP2-31361

Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free

Species: Hu

Applications: IHC, IHC-P, WB

TRIM50 Antibody -
BSA Free

NBP1-81988

Species: Hu

Applications: IHC, IHC-P

ZNF645 Antibody

NBP2-21037

Immunohistochemistry-Paraffin ZNF645 Antibody

Species: Hu

Applications: IHC, IHC-P, WB

Cadherin-13
Antibody [Unconjugate

AF3264

Immunocytochemistry Cadherin-13 Antibody [Unconjugated]

Simple Western Cadherin-13 Antibody [Unconjugated]

(20 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB

FZR1/CDH1 Antibody
[HRP]

NBP3-38164H

Species: Hu, Mu, Rt

Applications: WB, ELISA, ICC/IF

Publications for FZR1/CDH1 Antibody (NBP3-38164H) (0)

There are no publications for FZR1/CDH1 Antibody (NBP3-38164H).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FZR1/CDH1 Antibody (NBP3-38164H) (0)

There are no reviews for FZR1/CDH1 Antibody (NBP3-38164H). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

ICC/IF Video Protocol

FAQs for FZR1/CDH1 Antibody (NBP3-38164H) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional FZR1/CDH1 Products

Research Areas for FZR1/CDH1 Antibody (NBP3-38164H)

Find related products by research area.

Blogs on FZR1/CDH1

There are no specific blogs for FZR1/CDH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.

p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our FZR1/CDH1 Antibody [HRP] and receive a gift card or discount.

Bioinformatics

Gene Symbol

FZR1

Size / Catalog#	Qty	Price
NBP3-38164H 0.1 ml		$609.00
6-8 Business Days

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

FZR1/CDH1 Antibody [HRP]

Species Glossary

Images

Product Details

Order Details

FZR1/CDH1 Antibody [HRP] Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for FZR1/CDH1 Antibody [HRP]

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for FZR1/CDH1 Antibody (NBP3-38164H) (0)

Reviews for FZR1/CDH1 Antibody (NBP3-38164H) (0)

Product General Protocols

Video Protocols

FAQs for FZR1/CDH1 Antibody (NBP3-38164H) (0)

Secondary Antibodies

Isotype Controls

Additional FZR1/CDH1 Products

Research Areas for FZR1/CDH1 Antibody (NBP3-38164H)

Blogs on FZR1/CDH1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics