FYCO1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FYCO1 Antibody [NBP1-83698] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: FYCO1 Antibody [NBP1-83698] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FYCO1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IQEYYNKLCQEVTNRERNDQKMLADLDDLNRTKKYLEERLIELLRDKDALWQKSDALEFQQKLSAEERWLGDTEANHCLDCKREFS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FYCO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FYCO1 Protein (NBP1-83698PEP)
Publications
Read Publication using NBP1-83698.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25855459)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FYCO1 Antibody

  • DKFZp779K1152
  • FLJ13335
  • FYVE and coiled-coil domain containing 1
  • FYVE and coiled-coil domain-containing protein 1
  • MGC126517
  • RUFY3
  • RUN and FYVE domain containing 3
  • ZFYVE7MGC126519
  • Zinc finger FYVE domain-containing protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-15617
Species: Hu
NBP1-82029
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-85853
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-2220
Species: Hu, Mu, Rt, Po, Ba, Bv, Ca, SyHa, Pm, Ze
Applications: WB, Simple Western, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KO
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-83951
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NB300-318
Species: Hu, Mu, Rt
Applications: IP (-), WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P

Publications for FYCO1 Antibody (NBP1-83698)(1)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for FYCO1 Antibody (NBP1-83698) (0)

There are no reviews for FYCO1 Antibody (NBP1-83698). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FYCO1 Antibody (NBP1-83698) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FYCO1 Products

Bioinformatics Tool for FYCO1 Antibody (NBP1-83698)

Discover related pathways, diseases and genes to FYCO1 Antibody (NBP1-83698). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FYCO1 Antibody (NBP1-83698)

Discover more about diseases related to FYCO1 Antibody (NBP1-83698).
 

Pathways for FYCO1 Antibody (NBP1-83698)

View related products by pathway.

Blogs on FYCO1

There are no specific blogs for FYCO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FYCO1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FYCO1