FYCO1 Antibody

Immunocytochemistry/Immunofluorescence: FYCO1 Antibody [NBP1-83698] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.

Immunohistochemistry-Paraffin: FYCO1 Antibody [NBP1-83698] - Staining of human Skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: FYCO1 Antibody [NBP1-83698] - Staining of human Colon shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: FYCO1 Antibody [NBP1-83698] - Staining of human Heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: FYCO1 Antibody [NBP1-83698] - Staining of human Liver shows strong granular cytoplasmic positivity in hepatocytes.

Product Discontinued

FYCO1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IQEYYNKLCQEVTNRERNDQKMLADLDDLNRTKKYLEERLIELLRDKDALWQKSDALEFQQKLSAEERWLGDTEANHCLDCKREFS
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FYCO1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC reported in scientific literature (PMID: 25855459). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25855459)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FYCO1 Antibody

• DKFZp779K1152
• FLJ13335
• FYVE and coiled-coil domain containing 1
• FYVE and coiled-coil domain-containing protein 1
• MGC126517
• RUFY3
• RUN and FYVE domain containing 3
• ZFYVE7MGC126519
• Zinc finger FYVE domain-containing protein 7

Background

FYCO1, Fyve and Coiled-Coil domain-containing 1, is a gene that is lost in chromosomal deletions in nearly all types of solid tumors. FYCO1 forms a complex with LC3 and Rab7 that promotes microtubule plus end-directed transport of autophagic vesicles. It is possible that FYCO1 has membrane-tethering functions as well.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FYCO1 Antibody (NBP1-83698)(1)

Publication using NBP1-83698

• Camilla Raiborg, Eva M. Wenzel, Nina M. Pedersen et al. Repeated ER-endosome contacts promote endosome translocation and neurite outgrowth. Nature 2015-01-01 [PMID: 25855459] (IF/IHC)

Bioinformatics

• Gene Symbol: FYCO1