FXYD3 Antibody

Images

 
Western Blot: FXYD3 Antibody [H00005349-B01P] - Analysis of FXYD3 expression in transfected 293T cell line by FXYD3 polyclonal antibody. Lane 1: FXYD3 transfected lysate(9.68 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FXYD3 Antibody Summary

Immunogen
FXYD3 (AAH05238, 21 a.a. - 87 a.a.) full-length human protein. NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS
Specificity
FXYD3 - FXYD domain containing ion transport regulator 3,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FXYD3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FXYD3 Antibody

  • Chloride conductance inducer protein Mat-8
  • FXYD domain containing ion transport regulator 3
  • FXYD domain-containing ion transport regulator 3
  • Mammary tumor 8 kDa protein
  • MAT8MAT-8
  • phospholemman-like protein
  • Phospholemman-like
  • PLMLMGC111076

Background

This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-95165
Species: Mu, Rt
Applications: WB
NBP2-48725
Species: Hu
Applications: IHC, IHC-P, WB
H00010926-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
H00000486-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, ELISA(Cap), S-ELISA, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-06985
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-03498
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-81950
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-38904
Species: Hu
Applications: Flow, IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
NBP2-19807
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82486
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2957
Species: Hu
Applications: IHC, KO, WB
MAB6734
Species: Hu
Applications: IHC
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-00880
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for FXYD3 Antibody (H00005349-B01P) (0)

There are no publications for FXYD3 Antibody (H00005349-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FXYD3 Antibody (H00005349-B01P) (0)

There are no reviews for FXYD3 Antibody (H00005349-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FXYD3 Antibody (H00005349-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FXYD3 Products

Bioinformatics Tool for FXYD3 Antibody (H00005349-B01P)

Discover related pathways, diseases and genes to FXYD3 Antibody (H00005349-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FXYD3 Antibody (H00005349-B01P)

Discover more about diseases related to FXYD3 Antibody (H00005349-B01P).
 

Pathways for FXYD3 Antibody (H00005349-B01P)

View related products by pathway.

PTMs for FXYD3 Antibody (H00005349-B01P)

Learn more about PTMs related to FXYD3 Antibody (H00005349-B01P).

Blogs on FXYD3.

Myc-tag: The "Monkey Wrench" of Proteomic Tools
c-Myc is a well-characterized transcription factor encoded by the c-Myc gene on human chromosome 8q24. This cellular proto-oncogene, also known as p62, is commonly activated in a variety of tumor cells and plays a crucial role in cellular proliferatio...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FXYD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FXYD3
Entrez
Uniprot