FXC1 Antibody

Images

 
Immunohistochemistry-Paraffin: FXC1 Antibody [NBP2-14031] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FXC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLI HSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TIMM10B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FXC1 Protein (NBP2-14031PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FXC1 Antibody

  • fracture callus 1 (rat) homolog
  • fracture callus 1 homolog (rat)
  • Fracture callus protein 1
  • FxC1
  • TIM10B
  • Tim9b
  • TIMM10Bmitochondrial import inner membrane translocase subunit Tim9 B
  • TIMM9B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-80682
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92509
Species: Hu
Applications: WB, IHC, IHC-P
H00026520-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-40853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for FXC1 Antibody (NBP2-14031) (0)

There are no publications for FXC1 Antibody (NBP2-14031).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FXC1 Antibody (NBP2-14031) (0)

There are no reviews for FXC1 Antibody (NBP2-14031). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FXC1 Antibody (NBP2-14031) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FXC1 Products

Bioinformatics Tool for FXC1 Antibody (NBP2-14031)

Discover related pathways, diseases and genes to FXC1 Antibody (NBP2-14031). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FXC1

There are no specific blogs for FXC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FXC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMM10B