FUSIP1 Antibody [Alexa Fluor® 594]

Images

 

Product Details

Summary
Product Discontinued
View other related FUSIP1 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-38220AF594
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FUSIP1 Antibody [Alexa Fluor® 594] Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 163-262 of human FUSIP1 (NP_473357.1).

Sequence:
DRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSSGH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRSF10
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for FUSIP1 Antibody [Alexa Fluor® 594]

  • 40 kDa SR-repressor protein
  • FLJ43846
  • FUS interacting protein (serine-arginine rich) 1
  • FUS-interacting protein (serine-arginine rich) 2
  • FUS-interacting serine-arginine-rich protein 1
  • FUSIP1DKFZp686H0644
  • FUSIP2
  • neural-salient SR protein
  • NSSR
  • serine/arginine-rich splicing factor 10
  • serine-arginine repressor protein (40 kDa)
  • SFRS13
  • SFRS13A
  • Splicing factor SRp38
  • splicing factor, arginine/serine-rich 13
  • Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats
  • SR splicing factor 10
  • SRp38
  • SRrp40TLS-associated protein with SR repeats
  • TASR1TLS-associated SR protein
  • TASR2FUS interacting protein (serine/arginine-rich) 1
  • TASRFLJ30749
  • TLS-associated protein TASR
  • TLS-associated serine-arginine protein 1
  • TLS-associated serine-arginine protein 2
  • TLS-associated serine-arginine protein

Background

FUSIP1 product is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing. Alternative splicing of this gene results in at least two transcript variants encoding different isoforms. In addition, transcript variants utilizing alternative polyA sites exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5745
Species: Hu
Applications: IHC, WB
NBP1-86125
Species: Hu
Applications: IHC,  IHC-P
NBP2-47290
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00010921-M05
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
H00006428-M08
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NBP3-27724
Species: Hu
Applications: ICC/IF, IHC, WB
NBP2-19952
Species: Hu
Applications: ICC/IF, KD, WB
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-41367
Species: Hu, Mu, Po, Rt
Applications: IHC,  IHC-P, WB
NBP1-87103
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-84416
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for FUSIP1 Antibody (NBP3-38220AF594) (0)

There are no publications for FUSIP1 Antibody (NBP3-38220AF594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FUSIP1 Antibody (NBP3-38220AF594) (0)

There are no reviews for FUSIP1 Antibody (NBP3-38220AF594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FUSIP1 Antibody (NBP3-38220AF594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FUSIP1 Products

Research Areas for FUSIP1 Antibody (NBP3-38220AF594)

Find related products by research area.

Blogs on FUSIP1

There are no specific blogs for FUSIP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FUSIP1 Antibody [Alexa Fluor® 594] and receive a gift card or discount.

Bioinformatics

Gene Symbol SRSF10