FUK Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FUK Antibody [NBP1-83467] - Immunofluorescent staining of human cell line SiHa shows localization to vesicles.
Immunohistochemistry-Paraffin: FUK Antibody [NBP1-83467] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FUK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HCMAENVTREDFLVGRPPELGQGDADVAGYLQSARAQLWRELRDQPLTMAYVSSGSYSYMTSSASEFLLSLTLPGAPGAQIVHSQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FUK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FUK Protein (NBP1-83467PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FUK Antibody

  • EC 2.7.1.52
  • FLJ39408,1110046B12Rik
  • fucokinase
  • L-fucose kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB64091
Species: Hu
Applications: WB, ICC
NBP1-83357
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59386
Species: Hu
Applications: WB
NBP2-46466
Species: Hu
Applications: IHC
NBP1-77687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-89459
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB110-60017
Species: Mu, Rt, Bv(-), Ca(-), Hu(-), Po(-), Rb(-), Sh(-)
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5768
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16527
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83467
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FUK Antibody (NBP1-83467) (0)

There are no publications for FUK Antibody (NBP1-83467).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FUK Antibody (NBP1-83467) (0)

There are no reviews for FUK Antibody (NBP1-83467). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FUK Antibody (NBP1-83467) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FUK Products

Bioinformatics Tool for FUK Antibody (NBP1-83467)

Discover related pathways, diseases and genes to FUK Antibody (NBP1-83467). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FUK Antibody (NBP1-83467)

Discover more about diseases related to FUK Antibody (NBP1-83467).
 

Pathways for FUK Antibody (NBP1-83467)

View related products by pathway.

Blogs on FUK

There are no specific blogs for FUK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FUK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FUK