Recombinant Human FSD1L GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human FSD1L Protein [H00083856-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human FSD1L GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-311 of Human FSD1L full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPEEDNKIDHFILEHRKTNFDGLPRVKDERCWEIIDNIKGTEYTLSGLKFDSKYMNFRVRACNKAVAGEYSDPVTLETKALNFNLDNSSSHLNLKVEDTCVEWDPTGGKGQESKIKGKENKGRSGTPSPKRTSVGSRPPAVRGSRDRFTGESYTVLGDTAIESGQHYWEVKAQKDCKSYSVGVAYKTLGKFDQLGKTNTSWCIHVNNWLQNTFAAKHNNKVKALDVTVPEKIGVFCDFDGGQLSFYDANSKQLLYSFKTKFTQPVLPGFMVWCGGLSLSTGMQVPSAVRTLQKSENGMTGSASSLNNVVTQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
FSD1L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FSD1L GST (N-Term) Protein

  • CCDC10MGC45564
  • Coiled-coil domain-containing protein 10
  • CSDUFD1
  • cystatin and DUF19 domain containing 1
  • fibronectin type III and SPRY domain containing 1-like
  • FSD1 C-terminal like
  • FSD1 N-terminal like
  • FSD1 N-terminal-like protein
  • FSD1CL
  • FSD1-like protein
  • FSD1NLcoiled-coil domain containing 10
  • MIR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85540
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-46069
Species: Hu, Mu, Rt
Applications: WB
NBP2-85297
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
796-IC
Species: Mu
Applications: BA
DDX0390P-100
Species: Hu, Mu
Applications: B/N, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vivo
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
788-G8/CF
Species: Hu, Mu, Rt
Applications: BA
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-85137
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
AF3628
Species: Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, WB
7268-CT
Species: Hu
Applications: BA
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-15843
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005250-B02P
Species: Hu
Applications: ICC/IF, WB

Publications for FSD1L Recombinant Protein (H00083856-P02) (0)

There are no publications for FSD1L Recombinant Protein (H00083856-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FSD1L Recombinant Protein (H00083856-P02) (0)

There are no reviews for FSD1L Recombinant Protein (H00083856-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FSD1L Recombinant Protein (H00083856-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FSD1L Products

Bioinformatics Tool for FSD1L Recombinant Protein (H00083856-P02)

Discover related pathways, diseases and genes to FSD1L Recombinant Protein (H00083856-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for FSD1L Recombinant Protein (H00083856-P02)

View related products by pathway.

Blogs on FSD1L

There are no specific blogs for FSD1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FSD1L GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FSD1L