Recombinant Human FSD1L Protein

Images

 
SDS-Page: Recombinant Human FSD1L Protein [H00083856-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE

Order Details

Recombinant Human FSD1L Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-311 of Human FSD1L full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPEEDNKIDHFILEHRKTNFDGLPRVKDERCWEIIDNIKGTEYTLSGLKFDSKYMNFRVRACNKAVAGEYSDPVTLETKALNFNLDNSSSHLNLKVEDTCVEWDPTGGKGQESKIKGKENKGRSGTPSPKRTSVGSRPPAVRGSRDRFTGESYTVLGDTAIESGQHYWEVKAQKDCKSYSVGVAYKTLGKFDQLGKTNTSWCIHVNNWLQNTFAAKHNNKVKALDVTVPEKIGVFCDFDGGQLSFYDANSKQLLYSFKTKFTQPVLPGFMVWCGGLSLSTGMQVPSAVRTLQKSENGMTGSASSLNNVVTQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FSD1L

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FSD1L Protein

  • CCDC10MGC45564
  • Coiled-coil domain-containing protein 10
  • CSDUFD1
  • cystatin and DUF19 domain containing 1
  • fibronectin type III and SPRY domain containing 1-like
  • FSD1 C-terminal like
  • FSD1 N-terminal like
  • FSD1 N-terminal-like protein
  • FSD1CL
  • FSD1-like protein
  • FSD1NLcoiled-coil domain containing 10
  • MIR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76959
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-54903
Species: Hu
Applications: WB
NBP1-88617
Species: Hu
Applications: IHC, IHC-P
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
796-IC
Species: Mu
DDX0390P-100
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-55459
Species: Hu
Applications: ICC/IF
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF

Publications for FSD1L Recombinant Protein (H00083856-P02) (0)

There are no publications for FSD1L Recombinant Protein (H00083856-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FSD1L Recombinant Protein (H00083856-P02) (0)

There are no reviews for FSD1L Recombinant Protein (H00083856-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FSD1L Recombinant Protein (H00083856-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FSD1L Products

Bioinformatics Tool for FSD1L Recombinant Protein (H00083856-P02)

Discover related pathways, diseases and genes to FSD1L Recombinant Protein (H00083856-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for FSD1L Recombinant Protein (H00083856-P02)

View related products by pathway.

Blogs on FSD1L

There are no specific blogs for FSD1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FSD1L Antibody
NBP1-86583

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FSD1L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FSD1L