FSCB Antibody

Images

 
Western Blot: FSCB Antibody [NBP1-88417] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: ...read more
Immunocytochemistry/ Immunofluorescence: FSCB Antibody [NBP1-88417] - Staining of human cell line U-2 OS shows positivity in nuclei but not nucleoli.
Immunohistochemistry-Paraffin: FSCB Antibody [NBP1-88417] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FSCB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ADLLLTEEFPIGEASAEVSPPPSEQTPEDEALVENVSTEFQSPQVAGIPAVKLGSVVLEGEAKFEEVSKINSVLKDLSNTNDGQAPT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FSCB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FSCB Protein (NBP1-88417PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FSCB Antibody

  • C14orf155DKFZp686A1639
  • chromosome 14 open reading frame 155
  • DKFZp434F1017
  • DKFZp686J0539
  • fibrous sheath CABYR binding protein
  • fibrous sheath CABYR-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46403
Species: Hu
Applications: IHC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF3700
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-97719
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-14430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FSCB Antibody (NBP1-88417) (0)

There are no publications for FSCB Antibody (NBP1-88417).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FSCB Antibody (NBP1-88417) (0)

There are no reviews for FSCB Antibody (NBP1-88417). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FSCB Antibody (NBP1-88417) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FSCB Products

Bioinformatics Tool for FSCB Antibody (NBP1-88417)

Discover related pathways, diseases and genes to FSCB Antibody (NBP1-88417). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FSCB Antibody (NBP1-88417)

Discover more about diseases related to FSCB Antibody (NBP1-88417).
 

Pathways for FSCB Antibody (NBP1-88417)

View related products by pathway.

PTMs for FSCB Antibody (NBP1-88417)

Learn more about PTMs related to FSCB Antibody (NBP1-88417).

Blogs on FSCB

There are no specific blogs for FSCB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FSCB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FSCB