![Western Blot: FSBP Antibody [NBP2-84943] - WB Suggested Anti-FSBP Antibody Titration: 1.25ug/ml. Positive Control: Human Stomach](http://images.novusbio.com/fullsize2/FSBP Antibody-Western Blot-NBP2-84943-img0001.jpg "Western Blot: FSBP Antibody [NBP2-84943] - WB Suggested Anti-FSBP Antibody Titration: 1.25ug/ml. Positive Control: Human Stomach")
| Reactivity | Hu, Po, Bv, Eq, Gp, RbSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FSBP. Peptide sequence: KEYAKQELLQQKETQSDFKSNISEPTKKVMEMIPQISSFCLVRDRNHIQS The peptide sequence for this immunogen was taken from within the described region. |
| Predicted Species | Porcine (100%), Guinea Pig (93%), Bovine (100%), Rabbit (93%), Equine (100%). Backed by our 100% Guarantee. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FSBP |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Diseases for FSBP Antibody (NBP2-84943)Discover more about diseases related to FSBP Antibody (NBP2-84943).
| Pathways for FSBP Antibody (NBP2-84943)View related products by pathway.
|
PTMs for FSBP Antibody (NBP2-84943)Learn more about PTMs related to FSBP Antibody (NBP2-84943).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FSBP |
![Dual RNAscope ISH-IHC: Von Willebrand Factor Antibody [NB600-586] - Formalin-fixed paraffin-embedded tissue sections of human metastatic tonsil were probed for vWF mRNA (ACD RNAScope probe, catalog # 5860461; Fast Red chromogen, ACD catalog # 322500). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal (Novus catalog # NB600-586) at 1:500 dilution for 1 hour at room temperature followed by incubation with the anti-rabbit IgG VisUCyte HRP Polymer Antibody (Catalog # VC003) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue).](http://images.novusbio.com/images2/Von-Willebrand-Factor-Antibody-Dual-RNAscope-ISH-IHC-NB600-586-img0007.jpg)
![Immunohistochemistry: Von Willebrand Factor Antibody [NB600-586] - Formalin fixed paraffin embedded human tonsil stained with Factor VIII antibody.](http://images.novusbio.com/images2/Von-Willebrand-Factor-Antibody-Immunohistochemistry-NB600-586-img0001.jpg)
![Immunohistochemistry-Paraffin: Von Willebrand Factor Antibody [NB600-586] - Staining of formalin-fixed, paraffin-embedded Human Kidney sections with 1:2,000 Rabbit Anti-von Willebrand Factor.](http://images.novusbio.com/images2/Von-Willebrand-Factor-Antibody-Immunohistochemistry-Paraffin-NB600-586-img0005.jpg)
![Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of beta Amyloid on normal mouse brain (left) and 5xFAD mouse brain (right) using DAB with hematoxylin counterstain. The MOAB-2 antibody was used at 1:20 on normal mouse brain and at 1:400 on 5xFAD mouse brain.](http://images.novusbio.com/images2/beta-Amyloid-Antibody-(MOAB-2)-Immunohistochemistry-NBP2-13075-img0014.jpg)
![Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Analysis of beta Amyloid (MOAB-2) antibody in (1) 100 pmole beta Amyloid 42, (2) 5xFAD mouse brain homogenate Repetition 1 and (3) 5xFAD mouse brain homogenate Repetition 2.](http://images.novusbio.com/images2/beta-Amyloid-Antibody-(MOAB-2)-Western-Blot-NBP2-13075-img0017.jpg)
![Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Western blot analysis in cell lysates from HEK-APP SWE/BACE1 cells probed with an antibody against the C-terminus of APP (Lanes 1 and 2) and beta Amyloid (MOAB-2, Lanes 3 and 4). Beta Amyloid (MOAB-2) does not detect APP (from PMID: 22423893).](http://images.novusbio.com/images2/beta-Amyloid-Antibody-(MOAB-2)-Western-Blot-NBP2-13075-img0016.jpg)
![Western Blot: APBA1 Antibody [NBP2-41182] - Analysis of APBA1 in rat brain tissue lysate with APBA1 antibody at 0.5 ug/ml in (A) the absence and (B) the presence of blocking peptide.](http://images.novusbio.com/images2/APBA1-Antibody-Western-Blot-NBP2-41182-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: APBA1 Antibody [NBP2-41182] - Human brain tissue with APBA1 antibody at 20 ug/mL.](http://images.novusbio.com/images2/APBA1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-41182-img0003.jpg)
![Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.](http://images.novusbio.com/images2/Albumin-Antibody-Western-Blot-NB600-41532-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Albumin-Antibody-Immunocytochemistry-Immunofluorescence-NB600-41532-img0003.jpg)
![Western Blot: OXA1L Antibody [NBP2-93729] - Analysis of extracts of various cell lines, using OXA1L.Exposure time: 60s.](http://images.novusbio.com/images2/OXA1L Antibody-Western Blot-NBP2-93729-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: OXA1L Antibody [NBP2-93729] - Analysis of NIH/3T3 cells using OXA1L at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/images2/OXA1L-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93729-img0001.jpg)
![Immunohistochemistry-Paraffin: OXA1L Antibody [NBP2-93729] - Paraffin-embedded rat liver using OXA1L.](http://images.novusbio.com/images2/OXA1L-Antibody-Immunohistochemistry-Paraffin-NBP2-93729-img0002.jpg)
![Western Blot: Tau [p Thr181] Antibody [NB100-82245] - PPP2R2C level regulates Tau phosphatase levels. Representative image of immunoblots of indicated antibodies are shown in SHSY5Y cell lines after knockdown and overexpression PPP2R2C. Image collected and cropped by CiteAb from the following publication (www.aging-us.com/lookup/doi/10.18632/aging.103048) licensed under a CC-BY licence.](http://images.novusbio.com/images2/Tau-[p-Thr181]-Antibody-Western-Blot-NB100-82245-img0006.jpg)
![Immunohistochemistry-Paraffin: Tau [p Thr181] Antibody [NB100-82245] - analysis of paraffin-embedded rat hippocampal region tissue from a model with Alzheimer's Disease using Tau (phospho-Thr181) antibody.](http://images.novusbio.com/images2/Tau-[p-Thr181]-Antibody-Immunohistochemistry-Paraffin-NB100-82245-img0005.jpg)
![Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Western blot analysis of extract from mouse brain tissue using Tau (Ab-181) antibody ( Lane 1 and 2) and Tau (phospho-Thr181) antibody ( Lane 3 and 4).](http://images.novusbio.com/images2/Tau-[p-Thr181]-Antibody-Western-Blot-NB100-82245-img0003.jpg)
![Western Blot: GSK-3 beta Antibody (3D10) [NBP1-47470] - Analysis of GSK-3 beta in mouse beta cell line (betaTC3) using anti-GSK-3 beta antibody. Image from verified customer review.](http://images.novusbio.com/images2/GSK-3-beta-Antibody-(3D10)-Western-Blot-NBP1-47470-img0012.jpg)
![Immunocytochemistry/Immunofluorescence: GSK-3 beta Antibody (3D10) [NBP1-47470] - Analysis of NIH/3T3 (left) and U251 (right) cells using GSK3 beta mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.](http://images.novusbio.com/images2/GSK-3-beta-Antibody-(3D10)-Immunocytochemistry-Immunofluorescence-NBP1-47470-img0006.jpg)
![Immunohistochemistry: GSK-3 beta Antibody (3D10) [NBP1-47470] - Fap1-inhibition with SLV peptide increases phosphorylation of Fap1-substrates Fas and GSK-3 beta in a murine xenograft model. SW620 cells injected into flanks of athymic Nude mice & tumor volume was checked biweekly. Mice treated weekly with oxaliplatin (days 0, 7 and 14) & injected daily with Fap1 blocking SLV peptide, VLS control peptide, or treated with SLV or VLS peptide alone (n=12). Tumors were simultaneously harvested when control tumors were >2,000 mm3. SLV peptide increases Gsk3-phosphorylation with/without oxaliplatin. IF detection of total versus phospho- GSK-3 beta performed with DAPI staining of nuclei (areas without gland formation were selected). Image collected and cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.25401), licensed under a CC-BY licence.](http://images.novusbio.com/images2/GSK-3 beta Antibody (3D10)-Immunohistochemistry-NBP1-47470-img0014.jpg)
![Knockout Validated: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and TJP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:200 of Rabbit Anti-Human TJP1 Polyclonal Antibody (Catalog # NBP1-85047) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TJP1 at approximately 260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.](http://images.novusbio.com/images2/Tight-Junction-Protein-1-Antibody-Knockout-Validated-NBP1-85047-img0019.jpg)
![Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining in human testis and skeletal muscle tissues. Corresponding TJP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Tight-Junction-Protein-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85047-img0018.jpg)
![Simple Western: Tight Junction Protein 1 Antibody [NBP1-85047] - Simple Western lane view shows a specific band for TJP1 in 0.2 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.](http://images.novusbio.com/images2/Tight-Junction-Protein-1-Antibody-Simple-Western-NBP1-85047-img0006.jpg)
![Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human placenta shows high expression.](http://images.novusbio.com/images2/Steroid-sulfatase-Antibody-Immunohistochemistry-Paraffin-NBP1-90095-img0005.jpg)
![Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/images2/Steroid-sulfatase-Antibody-Immunohistochemistry-Paraffin-NBP1-90095-img0004.jpg)
![Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining in human placenta and pancreas tissues using anti-STS antibody. Corresponding STS RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Steroid sulfatase Antibody-Immunohistochemistry-Paraffin-NBP1-90095-img0006.jpg)
![Western Blot: GBA3 Antibody (1F1) [NBP2-00521] Analysis of extracts (35ug) from 9 different cell lines by using anti-GBA3 monoclonal antibody.](http://images.novusbio.com/images/GBA3 Antibody (1F1)-Western Blot-NBP2-00521-img0020.jpg)
![Immunohistochemistry: Cytosolic beta-Glucosidase/GBA3 Antibody (1F1) [NBP2-00521] - GBA3 Antibody (1F1) [NBP2-00521] - Staining of paraffin-embedded Human prostate tissue using anti-GBA3 mouse monoclonal antibody.](http://images.novusbio.com/images2/Cytosolic-beta-Glucosidase-GBA3-Antibody-(1F1)-Immunohistochemistry-NBP2-00521-img0021.jpg)
![Flow Cytometry: GBA3 Antibody (1F1) [NBP2-00521] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-GBA3 antibody, and then analyzed by flow cytometry.](http://images.novusbio.com/images/GBA3 Antibody (1F1)-Flow Cytometry-NBP2-00521-img0003.jpg)
-img0001.jpg)
![Western Blot: CCAR1 Antibody [NB500-186] - Necdin controls CCAR1 protein abundance in myogenic cells. Representative western blot showing expression of CCAR1 and necdin in primary myoblasts isolated from wt, Ndn-/-, tgMlcNec newborn mice. Proteins were detected using antibodies specific for CCAR1, necdin and beta-actin as control. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0043335), licensed under a CC-BY licence.](http://images.novusbio.com/images2/CCAR1-Antibody-Western-Blot-NB500-186-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: CCAR1 Antibody [NB500-186] - Necdin interacts with CCAR1/CARP1. Co-localization of necdin and CCAR1 in primary myoblasts of wt (C57/Bl6) mice. Images taken at confocal laser scanning microscope at 40x (i-v) and 63x (zoomed 1.67 times) magnification. Nuclei are stained with DAPI (i, vi; blue). Panels shows immunostaining experiment using the polyclonal anti-CCAR1 (ii, vii, Ab-CCAR1-red) or monoclonal anti-Ndn (iii, viii; Ab-Ndn-green). Panel iv shows the merged images of ii and iii and panel ix the merged images of vii and viii (Ab-CCAR1 + Ab-Ndn-yellow). Panel v shows the merged images of i, ii and iii and panel x the merged images of vi, vii, viii, (Ab-CCAR + Ab-Ndn + DAPI). Scale bar (i-iv) = 17 um; (vi-x) = 41,75 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0043335), licensed under a CC-BY licence.](http://images.novusbio.com/images2/CCAR1-Antibody-Immunocytochemistry-Immunofluorescence-NB500-186-img0011.jpg)
![Immunohistochemistry-Paraffin: CCAR1 Antibody [NB500-186] - Human stomach carcinoma (left) and mouse renal cell carcinoma (right). Antibody: Affinity purified rabbit anti-CCAR1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB](http://images.novusbio.com/images2/CCAR1-Antibody-Immunohistochemistry-Paraffin-NB500-186-img0004.jpg)