FSBP Antibody

Images

 
Western Blot: FSBP Antibody [NBP2-84943] - WB Suggested Anti-FSBP Antibody Titration: 1.25ug/ml. Positive Control: Human Stomach

Product Details

Summary
Reactivity Hu, Po, Bv, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FSBP Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FSBP. Peptide sequence: KEYAKQELLQQKETQSDFKSNISEPTKKVMEMIPQISSFCLVRDRNHIQS The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Porcine (100%), Guinea Pig (93%), Bovine (100%), Rabbit (93%), Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
FSBP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for FSBP Antibody

  • fibrinogen silencer binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-586
Species: Hu, Mu, Ca, Fe
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC
AF2656
Species: Hu
Applications: WB, IHC
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-41182
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-93729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-00521
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB500-186
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for FSBP Antibody (NBP2-84943) (0)

There are no publications for FSBP Antibody (NBP2-84943).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FSBP Antibody (NBP2-84943) (0)

There are no reviews for FSBP Antibody (NBP2-84943). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FSBP Antibody (NBP2-84943) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FSBP Products

Array NBP2-84943

Bioinformatics Tool for FSBP Antibody (NBP2-84943)

Discover related pathways, diseases and genes to FSBP Antibody (NBP2-84943). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FSBP Antibody (NBP2-84943)

Discover more about diseases related to FSBP Antibody (NBP2-84943).
 

Pathways for FSBP Antibody (NBP2-84943)

View related products by pathway.

PTMs for FSBP Antibody (NBP2-84943)

Learn more about PTMs related to FSBP Antibody (NBP2-84943).

Blogs on FSBP

There are no specific blogs for FSBP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FSBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FSBP