Home » FSBP » FSBP Antibodies » FSBP Antibody

FSBP Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: FSBP Antibody [NBP2-84943] - WB Suggested Anti-FSBP Antibody Titration: 1.25ug/ml. Positive Control: Human Stomach
Western Blot: FSBP Antibody [NBP2-84943] - WB Suggested Anti-FSBP Antibody Titration: 1.25ug/ml. Positive Control: Human Stomach

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

FSBP Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FSBP. Peptide sequence: KEYAKQELLQQKETQSDFKSNISEPTKKVMEMIPQISSFCLVRDRNHIQS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
FSBP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for FSBP Antibody

  • fibrinogen silencer binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Von Willebrand
Factor Antibody
NB600-586
Dual RNAscope ISH-IHC: Von Willebrand Factor Antibody [NB600-586] - Formalin-fixed paraffin-embedded tissue sections of human metastatic tonsil were probed for vWF mRNA (ACD RNAScope probe, catalog # 5860461; Fast Red chromogen, ACD catalog # 322500). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal (Novus catalog # NB600-586) at 1:500 dilution for 1 hour at room temperature followed by incubation with the anti-rabbit IgG VisUCyte HRP Polymer Antibody (Catalog # VC003) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue).
Immunohistochemistry-Frozen: Von Willebrand Factor Antibody [NB600-586] - Canine brain/spinal cord. VWF antibody in green. A pericyte marker in red. Alexa Fluor conjugated secondary antibodies were used for visualization. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry: Von Willebrand Factor Antibody [NB600-586] - Formalin fixed paraffin embedded human tonsil stained with Factor VIII antibody.
(3 Reviews)
(7 Publications)
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
SHBG [HRP]
DSHBG0B
(10 Publications)
Species: Hu
Applications: ELISA
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Mouse brain (cerebral cortex). Red: MOAB-2 antibody staining, Blue: DAPI. Zeiss LSM800, 40x. Image from verified customer review.
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) - BSA Free [NBP2-13075] - A plaque load in neocortex and hippocampus in APP/PS1 mice exposed to differential housing. Representative 10x MOAB-2 staining in hippocampus of APP/PS1 mice for each housing group. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28584278/) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Immunofluorescent detection of beta Amyloid with MOAB-2 in the subiculim of 1-, 2- and 4- month old 5xFAD mice. Scale bar 20 um (from PMID: 22423893).
(2 Reviews)
(48 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
APBA1 Antibody -
BSA Free
NBP2-41182
Immunocytochemistry/Immunofluorescence: APBA1 Antibody [NBP2-41182] - Human brain tissue with APBA1 antibody at 20 ug/mL.
Western Blot: APBA1 Antibody [NBP2-41182] - Analysis of APBA1 in rat brain tissue lysate with APBA1 antibody at 0.5 ug/ml in (A) the absence and (B) the presence of blocking peptide.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(3 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Follistatin [HRP]
DFN00
(32 Publications)
Species: Hu
Applications: ELISA
OXA1L Antibody
H00005018-D01P
Immunocytochemistry/Immunofluorescence: OXA1L Antibody [H00005018-D01P] - Analysis of antibody to OXA1L on HeLa cell. Antibody concentration 30 ug/ml.
Western Blot: OXA1L Antibody [H00005018-D01P] - Analysis of OXA1L expression in HepG2.
Western Blot: OXA1L Antibody [H00005018-D01P] - Analysis of OXA1L expression in transfected 293T cell line by OXA1L polyclonal antibody.Lane 1: OXA1L transfected lysate(48.50 KDa).Lane 2: Non-transfected lysate.
Species: Hu
Applications: ICC/IF, WB
Tau [p Thr181]
Antibody
NB100-82245
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Western blot analysis of extract from mouse brain tissue using Tau (Ab-181) antibody ( Lane 1 and 2) and Tau (phospho-Thr181) antibody ( Lane 3 and 4).
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Analysis of extracts from mouse brain tissue using Tau(Phospho-Thr181) Antibody and the same antibody preincubated with blocking peptide.
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - PPP2R2C level regulates Tau phosphatase levels. Representative image of immunoblots of indicated antibodies are shown in SHSY5Y cell lines after knockdown and overexpression PPP2R2C. Image collected and cropped by CiteAb from the following publication (www.aging-us.com/lookup/doi/10.18632/aging.103048) licensed under a CC-BY licence.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
GSK-3 beta
Antibody (3D10) - BSA
NBP1-47470
Flow Cytometry: GSK-3 beta Antibody (3D10) [NBP1-47470] - An intracellular stain was performed on HeLa cells with GSK-3 beta (3D10) antibody NBP1-47470PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Immunohistochemistry: GSK-3 beta Antibody (3D10) [NBP1-47470] - Fap1-inhibition with SLV peptide increases phosphorylation of Fap1-substrates Fas and GSK-3 beta in a murine xenograft model. SW620 cells injected into flanks of athymic Nude mice & tumor volume was checked biweekly. Mice treated weekly with oxaliplatin (days 0, 7 and 14) & injected daily with Fap1 blocking SLV peptide, VLS control peptide, or treated with SLV or VLS peptide alone (n=12). Tumors were simultaneously harvested when control tumors were >2,000 mm3. SLV peptide increases Gsk3-phosphorylation with/without oxaliplatin. IF detection of total versus phospho- GSK-3 beta performed with DAPI staining of nuclei (areas without gland formation were selected). Image collected and cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.25401), licensed under a CC-BY licence.
Simple Western: GSK-3 beta Antibody (3D10) [NBP1-47470] - Simple Western lane view shows a specific band for GSK-3 Beta in 0.5 mg/ml of Hek293 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(4 Reviews)
(7 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Tight Junction
Protein 1 Antibody
NBP1-85047
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. ICC/IF image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human cell line U-2 OS shows localization to cytosol & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.
(5 Reviews)
(12 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Steroid sulfatase
Antibody
NBP1-90095
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining in human placenta and pancreas tissues using anti-STS antibody. Corresponding STS RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human placenta shows high expression.
(3 Publications)
Species: Hu
Applications: IHC, IHC-P
Cytosolic
beta-Glucosidase/GBA3 ...
NBP2-00521
Flow Cytometry: GBA3 Antibody (1F1) [NBP2-00521] - Analysis of Hela cells, using anti-GBA3 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: GBA3 Antibody (1F1) [NBP2-00521] - Analysis of Jurkat cells, using anti-GBA3 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: GBA3 Antibody (1F1) [NBP2-00521] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-GBA3 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Serpin A6/Cortisol
Binding Globulin Anti ...
MAB3838
Serpin A6 was detected in perfusion fixed frozen sections of rat brain (preoptic nucleus) using Mouse Anti-Rat Serpin A6 Monoclonal Antibody (Catalog # MAB3838) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to neurons. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of rat olfactory bulb tissue, rat liver tissue, rat brain (cerebellum) tissue, and rat brain (hippocampus) tissue. PVDF membrane was probed with 0.2 µg/mL of Mouse Anti-Rat Serpin A6 Monoclonal Antibody (Catalog # MAB3838) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for Serpin A6 at approximately 50-60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Rt
Applications: IHC, WB
CCAR1 Antibody
NB500-186
Immunohistochemistry-Paraffin: CCAR1 Antibody [NB500-186] - Human stomach carcinoma (left) and mouse renal cell carcinoma (right). Antibody: Affinity purified rabbit anti-CCAR1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunoprecipitation: CCAR1 Antibody [NB500-186] - Detection of human CCAR1 by western blot of immunoprecipitates. Samples: Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CCAR1 antibody NB500-186 (lot NB500-186-2) used for IP at 6 ug/mg lysate. CCAR1 was also immunoprecipitated by a previous lot (lot NB500-186-1) of the antibody. For blotting immunoprecipitated CCAR1, NB500-186 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Western Blot: CCAR1 Antibody [NB500-186] - Necdin interacts with CCAR1/CARP1. Interaction of necdin and CCAR1 in C2C12 myoblasts and primary myoblast cells. Co-IP experiments were performed on protein extract from C2C12 transfected with pCMV-FLAG-Necdin (C2C12 pCMV-FLAG-Ndn) or primary myoblasts from C57/Bl6 newborn mice. Proteins were immunoprecipitated using the polyclonal anti-Ndn (alpha-Ndn) or polyclonal anti-CCAR1 (alpha-CCAR1) and with a non-specific rabbit antisera as control (IgG). Necdin and CCAR1 were detected in immunoprecipitated samples using specific antibody. Input (I) represents 10% of the immunoprecipitated proteins. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0043335), licensed under a CC-BY licence.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for FSBP Antibody (NBP2-84943) (0)

There are no publications for FSBP Antibody (NBP2-84943).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FSBP Antibody (NBP2-84943) (0)

There are no reviews for FSBP Antibody (NBP2-84943). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FSBP Antibody (NBP2-84943) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FSBP Products

Array NBP2-84943

Bioinformatics Tool for FSBP Antibody (NBP2-84943)

Discover related pathways, diseases and genes to FSBP Antibody (NBP2-84943). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FSBP Antibody (NBP2-84943)

Discover more about diseases related to FSBP Antibody (NBP2-84943).
 

Pathways for FSBP Antibody (NBP2-84943)

View related products by pathway.

PTMs for FSBP Antibody (NBP2-84943)

Learn more about PTMs related to FSBP Antibody (NBP2-84943).
 

Research Areas for FSBP Antibody (NBP2-84943)

Find related products by research area.

Blogs on FSBP

There are no specific blogs for FSBP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FSBP Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol FSBP